Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3JSAF7)

DOT Name Conserved oligomeric Golgi complex subunit 1 (COG1)
Synonyms COG complex subunit 1; Component of oligomeric Golgi complex 1
Gene Name COG1
Related Disease
COG1-congenital disorder of glycosylation ( )
ALG2-congenital disorder of glycosylation ( )
Cerebrocostomandibular syndrome ( )
Enterovirus infection ( )
Burkitt lymphoma ( )
Small lymphocytic lymphoma ( )
UniProt ID
COG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08700
Sequence
MATAATSPALKRLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLI
EAADTIGQMRRCAVGLVDAVKATDQYCARLRQAGSAAPRPPRAQQPQQPSQEKFYSMAAQ
IKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSSSSRYSPVLSRFPILIRQV
AAASHFRSTILHESKMLLKCQGVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQK
LLNQPHHGAGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITG
QHPAGKGTGVLQEEMKLCSWFKHLPASIVEFQPTLRTLAHPISQEYLKDTLQKWIHMCNE
DIKNGITNLLMYVKSMKGLAGIRDAMWELLTNESTNHSWDVLCRRLLEKPLLFWEDMMQQ
LFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESP
NDLPSDAAWVSVANRGQFASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDD
SSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQ
DALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPAREFRALRKQGKVKTQEI
IPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLDDAGSVLATATSWDELE
IQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQV
VAAYEKLSEEKQIKKEGAFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEK
VTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHN
ILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQVVPPARSTAGDPTVPGSLFRQLVSE
EDNTSAPSLFKLGWLSSMTK
Function Required for normal Golgi function.
Reactome Pathway
Intra-Golgi traffic (R-HSA-6811438 )
Retrograde transport at the Trans-Golgi-Network (R-HSA-6811440 )
COPI-mediated anterograde transport (R-HSA-6807878 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
COG1-congenital disorder of glycosylation DIS50OUW Definitive Autosomal recessive [1]
ALG2-congenital disorder of glycosylation DISIVO8V Strong Biomarker [2]
Cerebrocostomandibular syndrome DIS7SW2F Strong Genetic Variation [3]
Enterovirus infection DISH2UDP Strong Biomarker [4]
Burkitt lymphoma DIS9D5XU moderate Biomarker [5]
Small lymphocytic lymphoma DIS30POX moderate Biomarker [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Conserved oligomeric Golgi complex subunit 1 (COG1). [6]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Conserved oligomeric Golgi complex subunit 1 (COG1). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Conserved oligomeric Golgi complex subunit 1 (COG1). [14]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Conserved oligomeric Golgi complex subunit 1 (COG1). [18]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [7]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [9]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [10]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [12]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [15]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [16]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Conserved oligomeric Golgi complex subunit 1 (COG1). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2 Conserved oligomeric Golgi complex subunit 1 deficiency reveals a previously uncharacterized congenital disorder of glycosylation type II. Proc Natl Acad Sci U S A. 2006 Mar 7;103(10):3764-9. doi: 10.1073/pnas.0507685103. Epub 2006 Feb 28.
3 Cerebrocostomandibular-like syndrome and a mutation in the conserved oligomeric Golgi complex, subunit 1.Hum Mol Genet. 2009 Feb 1;18(3):517-24. doi: 10.1093/hmg/ddn379. Epub 2008 Nov 13.
4 CRISPR/Cas9-mediated gene knockout screens and target identification via whole-genome sequencing uncover host genes required for picornavirus infection. J Biol Chem. 2017 Jun 23;292(25):10664-10671. doi: 10.1074/jbc.M117.782425. Epub 2017 Apr 26.
5 Identification of novel fusion genes with 28S ribosomal DNA in hematologic malignancies.Int J Oncol. 2014 Apr;44(4):1193-8. doi: 10.3892/ijo.2014.2291. Epub 2014 Feb 5.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
11 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
17 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
18 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.