Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3O4INM)

• DOT Name: Integrator complex subunit 15 (INTS15)
• Gene Name: INTS15
• UniProt ID: INT15_HUMAN
• Pfam ID: PF14964
• Sequence:
  MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERS
  AQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM
  AVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQ
  FITSVTALYDLSSDDLIPPMDLLEMIVTWIFEDPRLILITFLNTPIAANLPIGFLELTPL
  VGLIRWCVKAPLAYKRKKKPPLSNGHVSNKVTKDPGVGMDRDSHLLYSKLHLSVLQVLMT
  LQLHLTEKNLYGRLGLILFDHMVPLVEEINRLADELNPLNASQEIELSLDRLAQALQVAM
  ASGALLCTRDDLRTLCSRLPHNNLLQLVISGPVQQSPHAALPPGFYPHIHTPPLGYGAVP
  AHPAAHPALPTHPGHTFISGVTFPFRPIR
• Function: Probable component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Integrator complex subunit 15 (INTS15).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Integrator complex subunit 15 (INTS15).	[3]
Selenium	DM25CGV	Approved	Selenium increases the expression of Integrator complex subunit 15 (INTS15).	[4]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Integrator complex subunit 15 (INTS15).	[2]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Integrator complex subunit 15 (INTS15).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Integrator complex subunit 15 (INTS15).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Integrator complex subunit 15 (INTS15).	[6]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.