Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT75KVQK)

DOT Name CAP-Gly domain-containing linker protein 4 (CLIP4)
Synonyms Restin-like protein 2
Gene Name CLIP4
Related Disease
Renal cell carcinoma ( )
Gastric cancer ( )
Gastritis ( )
Stomach cancer ( )
UniProt ID
CLIP4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2Z0W
Pfam ID
PF12796 ; PF01302
Sequence
MTIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
FDPKTSVSELFAILRQWVPQVQQNIDIIGNEILKRGCNVNDRDGLTDMTLLHYTCKSGAH
GIGDVETAVKFATQLIDLGADISLRSRWTNMNALHYAAYFDVPELIRVILKTSKPKDVDA
TCSDFNFGTALHIAAYNLCAGAVKCLLEQGANPAFRNDKGQIPADVVPDPVDMPLEMADA
AATAKEIKQMLLDAVPLSCNISKAMLPNYDHVTGKAMLTSLGLKLGDRVVIAGQKVGTLR
FCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYGIFAPLSKISKAKGRRKNIT
HTPSTKAAVPLIRSQKIDVAHVTSKVNTGLMTSKKDSASESTLSLPPGEELKTVTEKDVA
LLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRASAGLNSSATSTANNSR
CEGELRLGERVLVVGQRLGTIRFFGTTNFAPGYWYGIELEKPHGKNDGSVGGVQYFSCSP
RYGIFAPPSRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKS
KAALRRSWSSTPTAGGIEGSVKLHEGSQVLLTSSNEMGTVRYVGPTDFASGIWLGLELRS
AKGKNDGSVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKLVDENC

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Renal cell carcinoma DISQZ2X8 Strong Biomarker [1]
Gastric cancer DISXGOUK moderate Genetic Variation [2]
Gastritis DIS8G07K moderate Biomarker [3]
Stomach cancer DISKIJSX moderate Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Artesunate DMR27C8 Approved CAP-Gly domain-containing linker protein 4 (CLIP4) increases the response to substance of Artesunate. [18]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of CAP-Gly domain-containing linker protein 4 (CLIP4). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of CAP-Gly domain-containing linker protein 4 (CLIP4). [16]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [8]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [9]
Estradiol DMUNTE3 Approved Estradiol affects the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [10]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [11]
Testosterone DM7HUNW Approved Testosterone increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [12]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [13]
Bortezomib DMNO38U Approved Bortezomib increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [14]
Cidofovir DMA13GD Approved Cidofovir decreases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [9]
Clodronate DM9Y6X7 Approved Clodronate increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [9]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of CAP-Gly domain-containing linker protein 4 (CLIP4). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 FOXC2 and CLIP4 : a potential biomarker for synchronous metastasis of ?-cm clear cell renal cell carcinomas.Oncotarget. 2016 Aug 9;7(32):51423-51434. doi: 10.18632/oncotarget.9842.
2 A novel scoring system for gastric cancer risk assessment based on the expression of three CLIP4 DNA methylation-associated genes.Int J Oncol. 2018 Aug;53(2):633-643. doi: 10.3892/ijo.2018.4433. Epub 2018 Jun 6.
3 Early detection of gastric cancer using global, genome-wide and IRF4, ELMO1, CLIP4 and MSC DNA methylation in endoscopic biopsies.Oncotarget. 2017 Jun 13;8(24):38501-38516. doi: 10.18632/oncotarget.16258.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
7 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
10 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
11 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
14 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
15 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
18 Factors determining sensitivity or resistance of tumor cell lines towards artesunate. Chem Biol Interact. 2010 Apr 15;185(1):42-52.