Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8YRGCM)

DOT Name	Dehydrogenase/reductase SDR family member 1 (DHRS1)
Synonyms	EC 1.1.1.-; Short chain dehydrogenase/reductase family 19C member 1; Protein SDR19C1
Gene Name	DHRS1
UniProt ID	DHRS1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2QQ5
EC Number	1.1.1.-
Pfam ID	PF00106
Sequence	MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVP VVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDIN NVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHE LRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALA TDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLR VPKWIIALYTSKF
Function	NADPH-dependent oxidoreductase which catalyzes the reduction of steroids (estrone, androstene-3,17-dione and cortisone) as well as prostaglandin E1, isatin and xenobiotics in vitro. May have a role in steroid and/or xenobiotic metabolism.
Tissue Specificity	Detected in heart, liver, adrenal glands, and at low levels in skeletal muscle, kidney, pancreas and brain.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[1]
------------------------------------------------------------------------------------

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[7]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[8]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[10]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Dehydrogenase/reductase SDR family member 1 (DHRS1).	[12]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

References

1	Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
4	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
7	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8	Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
9	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
10	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
11	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
12	Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.