Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT93X5W2)

• DOT Name: EP300-interacting inhibitor of differentiation 2B (EID2B)
• Synonyms: EID-2B; EID-2-like inhibitor of differentiation 3; EID-3
• Gene Name: EID2B
• UniProt ID: EID2B_HUMAN
• Sequence:
  MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARM
  PGPVPGPIPSSVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRL
  FVEGCKAREAAFDADPPQMDFAAVAFTVALTASEALSPLAD
• Function: Acts as a repressor of MYOD-dependent transcription, glucocorticoid receptor-dependent transcription, and muscle differentiation.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of EP300-interacting inhibitor of differentiation 2B (EID2B).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [10] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.