Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT94GKE1)

• DOT Name: Protein ABHD14A (ABHD14A)
• Synonyms: EC 3.-.-.-; Alpha/beta hydrolase domain-containing protein 14A; Abhydrolase domain-containing protein 14A
• Gene Name: ABHD14A
• UniProt ID: ABHEA_HUMAN
• EC Number: 3.-.-.-
• Pfam ID: PF12697
• Sequence:
  MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTS
  CLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLS
  QRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPF
  LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHS
  VVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
• Function: Possible role in granule neuron development.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein ABHD14A (ABHD14A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein ABHD14A (ABHD14A).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein ABHD14A (ABHD14A).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein ABHD14A (ABHD14A).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein ABHD14A (ABHD14A).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Protein ABHD14A (ABHD14A).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Protein ABHD14A (ABHD14A).	[8]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Protein ABHD14A (ABHD14A).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein ABHD14A (ABHD14A).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein ABHD14A (ABHD14A).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [10] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.