General Information of Drug Off-Target (DOT) (ID: OTBMJUOC)

DOT Name Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4)
Synonyms EC 2.7.11.1; HPK/GCK-like kinase HGK; MAPK/ERK kinase kinase kinase 4; MEK kinase kinase 4; MEKKK 4; Nck-interacting kinase
Gene Name MAP4K4
UniProt ID
M4K4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4OBO; 4OBP; 4OBQ; 4RVT; 4U3Y; 4U3Z; 4U40; 4U41; 4U42; 4U43; 4U44; 4U45; 4ZK5; 4ZP5; 5DI1; 5J95; 5W5Q
EC Number
2.7.11.1
Pfam ID
PF00780 ; PF00069
Sequence
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
VLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPP
PPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSIE
PRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSSKSEGSPSQRL
ENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDD
VEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGS
VVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYP
LINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDL
EGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEE
GQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDE
GVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRA
QRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
Function
Serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway. Phosphorylates SMAD1 on Thr-322.
Tissue Specificity Widely expressed. Isoform 5 is abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Reactome Pathway
Oxidative Stress Induced Senescence (R-HSA-2559580 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [1]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [18]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [18]
Sulfate DMW0ZBF Investigative Sulfate affects the methylation of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [26]
------------------------------------------------------------------------------------
24 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [7]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [9]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [10]
Menadione DMSJDTY Approved Menadione affects the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [11]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [12]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [13]
Aspirin DM672AH Approved Aspirin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [14]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [9]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [15]
Sertraline DM0FB1J Approved Sertraline decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [16]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [17]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [19]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [20]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [21]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [22]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [23]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [24]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl decreases the expression of Mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4). [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
7 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
10 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
11 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
13 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
14 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
15 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
16 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
17 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
18 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
19 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
20 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
21 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
22 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
23 Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
24 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
25 Toxicogenomic analysis identifies the apoptotic pathway as the main cause of hepatotoxicity induced by tributyltin. Food Chem Toxicol. 2016 Nov;97:316-326. doi: 10.1016/j.fct.2016.09.027. Epub 2016 Sep 24.
26 Short-term airborne particulate matter exposure alters the epigenetic landscape of human genes associated with the mitogen-activated protein kinase network: a cross-sectional study. Environ Health. 2014 Nov 13;13:94. doi: 10.1186/1476-069X-13-94.