Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD1SQKM)

• DOT Name: Homeobox protein CDX-4 (CDX4)
• Synonyms: Caudal-type homeobox protein 4
• Gene Name: CDX4
• Related Disease:
  Acute erythroid leukemia
  Acute leukaemia
  Esophageal squamous cell carcinoma
  leukaemia
  Leukemia
• UniProt ID: CDX4_HUMAN
• Pfam ID: PF04731 ; PF00046
• Sequence:
  MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMP
  SMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVG
  GGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVY
  TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFE
  NSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute erythroid leukemia	DISZFC1O	Strong	Biomarker	[1]
Acute leukaemia	DISDQFDI	Strong	Altered Expression	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[3]
leukaemia	DISS7D1V	Strong	Altered Expression	[2]
Leukemia	DISNAKFL	Strong	Altered Expression	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Homeobox protein CDX-4 (CDX4).	[4]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Homeobox protein CDX-4 (CDX4).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Homeobox protein CDX-4 (CDX4).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Homeobox protein CDX-4 (CDX4).	[6]

References

• [1] The ParaHox gene Cdx4 induces acute erythroid leukemia in mice.Blood Adv. 2019 Nov 26;3(22):3729-3739. doi: 10.1182/bloodadvances.2019000761.
• [2] Cdx4 dysregulates Hox gene expression and generates acute myeloid leukemia alone and in cooperation with Meis1a in a murine model.Proc Natl Acad Sci U S A. 2006 Nov 7;103(45):16924-9. doi: 10.1073/pnas.0604579103. Epub 2006 Oct 26.
• [3] Dysregulated expression of HOX and ParaHOX genes in human esophageal squamous cell carcinoma.Oncol Rep. 2007 Apr;17(4):753-60.
• [4] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.