Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTEN8ID2)
| DOT Name | Claudin-6 (CLDN6) | ||||
|---|---|---|---|---|---|
| Synonyms | Skullin | ||||
| Gene Name | CLDN6 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLT SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
||||
| Function | Plays a major role in tight junction-specific obliteration of the intercellular space; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells. | ||||
| Tissue Specificity | Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
11 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
