General Information of Drug Off-Target (DOT) (ID: OTEWQJ6B)

DOT Name Neuropeptide Y receptor type 2 (NPY2R)
Synonyms NPY2-R; NPY-Y2 receptor; Y2 receptor
Gene Name NPY2R
UniProt ID
NPY2R_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7X9B; 7YON; 7YOO
Pfam ID
PF00001
Sequence
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
Tissue Specificity High levels in amygdala, corpus callosum, hippocampus and subthalamic nucleus. Also detectable in caudate nucleus, hypothalamus and substantia nigra.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Neuropeptide Y receptor type 2 (NPY2R). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Neuropeptide Y receptor type 2 (NPY2R). [8]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [3]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [4]
Triclosan DMZUR4N Approved Triclosan increases the expression of Neuropeptide Y receptor type 2 (NPY2R). [5]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [6]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [4]
Methamphetamine DMPM4SK Approved Methamphetamine increases the expression of Neuropeptide Y receptor type 2 (NPY2R). [7]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [4]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 affects the expression of Neuropeptide Y receptor type 2 (NPY2R). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Neuropeptide Y receptor type 2 (NPY2R). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
3 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
5 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
6 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
7 Protective effect of neuropeptide Y2 receptor activation against methamphetamine-induced brain endothelial cell alterations. Toxicol Lett. 2020 Nov 1;334:53-59. doi: 10.1016/j.toxlet.2020.09.013. Epub 2020 Sep 18.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
10 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.