Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFOHYHK)

• DOT Name: Interferon alpha-inducible protein 27-like protein 2 (IFI27L2)
• Synonyms: Interferon-stimulated gene 12b protein; ISG12(b); ISG12B; Protein TLH29; pIFI27-like protein
• Gene Name: IFI27L2
• UniProt ID: I27L2_HUMAN
• Pfam ID: PF06140
• Sequence:
  MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLV
  ATLQSVGAAGLSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPK
  PPLKSEKHEE
• Function: Plays a role in the apoptotic process and has a pro-apoptotic activity.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[9]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Interferon alpha-inducible protein 27-like protein 2 (IFI27L2).	[4]

References

• [1] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [2] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [3] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [8] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.