Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGZHJ7K)

• DOT Name: Protein FAM181B (FAM181B)
• Gene Name: FAM181B
• UniProt ID: F181B_HUMAN
• PDB ID: 6SEO
• Pfam ID: PF15238
• Sequence:
  MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVR
  EATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSA
  ADTPAKRPLAAPSAPTVAAPAHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAE
  PAGGEVAAPAAGLGGAGTGGAGGDVAGPAGATAIPGARKVPLRARNLPPSFFTEPSRAGG
  GGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAVLLAAEPLDVFPAGASVLRGP
  PELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADS
  PGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAGYSRTAYSSLWRSDGVWEGAPGE
  EGAHRD

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein FAM181B (FAM181B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein FAM181B (FAM181B).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Protein FAM181B (FAM181B).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Protein FAM181B (FAM181B).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Protein FAM181B (FAM181B).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Protein FAM181B (FAM181B).	[3]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Protein FAM181B (FAM181B).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein FAM181B (FAM181B).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM181B (FAM181B).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.