Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL30JKT)

DOT Name Nuclear body protein SP140-like protein (SP140L)
Gene Name SP140L
Related Disease
Primary biliary cholangitis ( )
UniProt ID
SP14L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00439 ; PF03172 ; PF00628 ; PF01342
Sequence
MAGGGSDLSTRGLNGGVSQVANEMNHLPAHSQSLQRLFTEDQDVDEGLVYDTVFKHFKRH
KLEISNAIKKTFPFLEGLRDRELITNKMFEDSEDSCRNLVPVQRVVYNVLSELEKTFNLS
VLEALFSEVNMQEYPDLIHIYKSFKNAIQDKLSFQESDRKEREERPDIKLSLKQGEVPES
PEARKESDQACGKMDTVDIANNSTLGKPKRKRRKKKGHGWSRMGTRTQKNNQQNDNSKAD
GQLVSSEKKANMNLKDLSKIRGRKRGKPGTHFTQSDRAPQKRVRSRASRKHKDETVDFQA
PLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIKGGYARSKNWRLSVRCG
GWPLRRLMEEGSLPNPPRIYYRNKKRILKSQNNSSVDPCMRNLDECEVCRDGGELFCCDT
CSRVFHEDCHIPPVESEKTPWNCIFCRMKESPGSQQCCQESEVLERQMCPEEQLKCEFLL
LKVYCCSESSFFAKIPYYYYIREACQGLKEPMWLDKIKKRLNEHGYPQVEGFVQDMRLIF
QNHRASYKYKDFGQMGLRLEAEFEKDFKEVFAIQETNGNS

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Primary biliary cholangitis DIS43E0O Definitive Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Nuclear body protein SP140-like protein (SP140L). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Nuclear body protein SP140-like protein (SP140L). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Nuclear body protein SP140-like protein (SP140L). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Nuclear body protein SP140-like protein (SP140L). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Nuclear body protein SP140-like protein (SP140L). [6]
Testosterone DM7HUNW Approved Testosterone increases the expression of Nuclear body protein SP140-like protein (SP140L). [7]
Triclosan DMZUR4N Approved Triclosan increases the expression of Nuclear body protein SP140-like protein (SP140L). [8]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Nuclear body protein SP140-like protein (SP140L). [9]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Nuclear body protein SP140-like protein (SP140L). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Nuclear body protein SP140-like protein (SP140L). [9]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Nuclear body protein SP140-like protein (SP140L). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Nuclear body protein SP140-like protein (SP140L). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Nuclear body protein SP140-like protein (SP140L). [10]
geraniol DMS3CBD Investigative geraniol increases the expression of Nuclear body protein SP140-like protein (SP140L). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Nuclear body protein SP140-like protein (SP140L). [11]
------------------------------------------------------------------------------------

References

1 SP140L, an Evolutionarily Recent Member of the SP100 Family, Is an Autoantigen in Primary Biliary Cirrhosis.J Immunol Res. 2015;2015:526518. doi: 10.1155/2015/526518. Epub 2015 Aug 11.
2 Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
7 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
8 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
13 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.