Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL32QH7)

• DOT Name: Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10)
• Synonyms: Glucose transporter type 10; GLUT-10
• Gene Name: SLC2A10
• Related Disease:
  Arterial tortuosity syndrome
  Familial thoracic aortic aneurysm and aortic dissection
• UniProt ID: GTR10_HUMAN
• Pfam ID: PF00083
• Sequence:
  MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
  ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC
  IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL
  SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL
  FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
  LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN
  EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
  SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL
  LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA
  S
• Function: Facilitative glucose transporter required for the development of the cardiovascular system.
• Tissue Specificity: Widely expressed; highest levels in liver and pancreas.
• Reactome Pathway:
  Defective SLC2A10 causes arterial tortuosity syndrome (ATS) (R-HSA-5619068)
  Cellular hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arterial tortuosity syndrome	DISWG36B	Definitive	Autosomal recessive	[1]
Familial thoracic aortic aneurysm and aortic dissection	DIS069FB	Limited	Autosomal dominant	[2]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[9]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[11]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[12]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[13]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[14]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[15]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[17]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[16]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[18]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Solute carrier family 2, facilitated glucose transporter member 10 (SLC2A10).	[10]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [12] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [13] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [14] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [15] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [16] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [17] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [18] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.