General Information of Drug Off-Target (DOT) (ID: OTMBLLRF)

DOT Name Interleukin-17D (IL17D)
Synonyms IL-17D; Interleukin-27; IL-27
Gene Name IL17D
UniProt ID
IL17D_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF06083
Sequence
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNDAPAGP
Function Induces expression of IL6, CXCL8/IL8, and CSF2/GM-CSF from endothelial cells.
Tissue Specificity Expressed preferentially in adipose, skeletal muscle and CNS.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
C-type lectin receptor sig.ling pathway (hsa04625 )
IL-17 sig.ling pathway (hsa04657 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Interleukin-17D (IL17D). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Interleukin-17D (IL17D). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Interleukin-17D (IL17D). [11]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Interleukin-17D (IL17D). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Interleukin-17D (IL17D). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Interleukin-17D (IL17D). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Interleukin-17D (IL17D). [5]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Interleukin-17D (IL17D). [6]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Interleukin-17D (IL17D). [7]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Interleukin-17D (IL17D). [8]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of Interleukin-17D (IL17D). [7]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Interleukin-17D (IL17D). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
11 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.