Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN7QK8F)

• DOT Name: MAP6 domain-containing protein 1 (MAP6D1)
• Synonyms: 21 kDa STOP-like protein; SL21
• Gene Name: MAP6D1
• UniProt ID: MA6D1_HUMAN
• Pfam ID: PF21410
• Sequence:
  MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDS
  GRDVPLTQYQRDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPI
  GDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKK
  FTPNPSAIFQASAPRILNV
• Function: May have microtubule-stabilizing activity.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of MAP6 domain-containing protein 1 (MAP6D1).	[6]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of MAP6 domain-containing protein 1 (MAP6D1).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of MAP6 domain-containing protein 1 (MAP6D1).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of MAP6 domain-containing protein 1 (MAP6D1).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.