Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN85925)

DOT Name MAP7 domain-containing protein 2 (MAP7D2)
Gene Name MAP7D2
UniProt ID
MA7D2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05672
Sequence
MERGGGGSGTGSRPEGTARGTSLPGKIAEPGAVRTSQPNYRPQGMEGFLKSDERQRLAKE
RREEREKCLAAREQQILEKQKRARLQYEKQMEERWRKLEEQRQREDQKRAAVEEKRKQKL
REEEERLEAMMRRSLERTQQLELKKKYSWGAPLAIGPGGHDACDKLSTSTMSLPKPTEPP
MNKRLSSSTVAISYSPDRVFHVCPRLAPLGPLNPSYKSSPTRNIEKKKATSTSTSGAGDV
GKEALSGGEASLVEKVKRGQRTATSLPVVNFGSPLRRCEFSGGIPKRPSSPVISKTATKA
YPQSPKTTKPPYPGSPVKYRLPALSGQDMPKRKAEKEKSNKEREGTLAQQAAGPQGEEAL
EKHVVDKHASEKHAAAAGGKAENSAALGKPTAGTTDAGEAAKILAEKRRQARLQKEQEEQ
ERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEERKRQEEEKKKQEGEEKRKAGEEA
KRKAEEELLLKEKQEQEKQEKAMIEKQKEAAETKAREVAEQMRLEREQIMLQIEQERLER
KKRIDEIMKRTRKSDVSPQVKKEDPKVGVQPAVCVEKKTKLVVPNKMEINGLNTCQEVNG
VDHAAPETYPQDIFSNGLKPAGGLIHLDALDGKSNSLDDSTEEVQSMDVSPVSKEELISI
PEFSPVSEMIPGVSLDQNGTGNARALQDLLDFTGPPTFPKRSSENLSLDDCNKNLIEGFN
SPGQETPLNTFC

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [3]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [4]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [5]
Testosterone DM7HUNW Approved Testosterone increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [5]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [6]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [7]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of MAP7 domain-containing protein 2 (MAP7D2). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [12]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of MAP7 domain-containing protein 2 (MAP7D2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of MAP7 domain-containing protein 2 (MAP7D2). [10]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
6 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
7 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
12 Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
13 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.