Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN9XBAM)

DOT Name Protein FAM24B (FAM24B)
Gene Name FAM24B
UniProt ID
FA24B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15193
Sequence
MPVIAGGILAALLLLIVVVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTI
ATESCPALQCCEGYRMCASFDSLPPCCCDINEGL

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Protein FAM24B (FAM24B). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Protein FAM24B (FAM24B). [6]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein FAM24B (FAM24B). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Protein FAM24B (FAM24B). [3]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Protein FAM24B (FAM24B). [4]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protein FAM24B (FAM24B). [5]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Protein FAM24B (FAM24B). [7]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of Protein FAM24B (FAM24B). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
8 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.