Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNT12G2)

DOT Name Nuclear pore complex protein Nup98-Nup96 (NUP98)
Synonyms EC 3.4.21.-
Gene Name NUP98
Related Disease
Chromosomal disorder ( )
Acute megakaryoblastic leukemia ( )
Acute myelomonocytic leukemia M4 ( )
Advanced cancer ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Anemia ( )
Astrocytoma ( )
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive ( )
Breast cancer ( )
Breast carcinoma ( )
Childhood acute megakaryoblastic leukemia ( )
Chronic myelomonocytic leukemia ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epilepsy ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioma ( )
Haematological malignancy ( )
Hepatocellular carcinoma ( )
leukaemia ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoid leukemia ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Promyelocytic leukaemia ( )
Stomach cancer ( )
Systemic lupus erythematosus ( )
T-cell acute lymphoblastic leukaemia ( )
Myeloid leukaemia ( )
Small lymphocytic lymphoma ( )
Glioblastoma multiforme ( )
Acute leukaemia ( )
Adult glioblastoma ( )
Childhood myelodysplastic syndrome ( )
Chronic myelomonocytic leukaemia ( )
Leukemia ( )
Myeloproliferative neoplasm ( )
Neuroblastoma ( )
Schizophrenia ( )
Triple negative breast cancer ( )
UniProt ID
NUP98_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1KO6; 2Q5X; 2Q5Y; 3MMY; 4OWR; 5A9Q; 6BZM; 7F60; 7F90; 7MNI; 7PEQ; 7Q64; 7Q65; 7Q66; 7Q67; 7VPG; 7VPH
EC Number
3.4.21.-
Pfam ID
PF04096 ; PF12110 ; PF21240
Sequence
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGL
FSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAV
GSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIF
GSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFG
APQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAA
QKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDRE
EIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGD
VNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS
TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLD
TMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIP
STSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMG
RSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDL
PEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEE
EVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTA
SISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS
DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEG
LWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAK
AVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERS
SLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKD
RLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE
LRSLTQSYLRELAVGSL
Function
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. NUP98 and NUP96 are involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC. In cooperation with DHX9, plays a role in transcription and alternative splicing activation of a subset of genes. Involved in the localization of DHX9 in discrete intranuclear foci (GLFG-body) ; (Microbial infection) Interacts with HIV-1 capsid protein P24 and nucleocapsid protein P7 and may thereby promote the integration of the virus in the host nucleus (in vitro). Binding affinity to HIV-1 CA-NC complexes bearing the capsid change Asn-74-Asp is reduced (in vitro).
KEGG Pathway
Nucleocytoplasmic transport (hsa03013 )
Amyotrophic lateral sclerosis (hsa05014 )
Influenza A (hsa05164 )
Reactome Pathway
Transport of the SLBP independent Mature mRNA (R-HSA-159227 )
Transport of the SLBP Dependant Mature mRNA (R-HSA-159230 )
Transport of Mature mRNA Derived from an Intronless Transcript (R-HSA-159231 )
Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236 )
Rev-mediated nuclear export of HIV RNA (R-HSA-165054 )
Transport of Ribonucleoproteins into the Host Nucleus (R-HSA-168271 )
NS1 Mediated Effects on Host Pathways (R-HSA-168276 )
Viral Messenger RNA Synthesis (R-HSA-168325 )
NEP/NS2 Interacts with the Cellular Export Machinery (R-HSA-168333 )
Regulation of Glucokinase by Glucokinase Regulatory Protein (R-HSA-170822 )
Nuclear import of Rev protein (R-HSA-180746 )
Vpr-mediated nuclear import of PICs (R-HSA-180910 )
snRNP Assembly (R-HSA-191859 )
SUMOylation of DNA damage response and repair proteins (R-HSA-3108214 )
SUMOylation of ubiquitinylation proteins (R-HSA-3232142 )
Nuclear Pore Complex (NPC) Disassembly (R-HSA-3301854 )
Regulation of HSF1-mediated heat shock response (R-HSA-3371453 )
SUMOylation of SUMOylation proteins (R-HSA-4085377 )
SUMOylation of chromatin organization proteins (R-HSA-4551638 )
SUMOylation of RNA binding proteins (R-HSA-4570464 )
SUMOylation of DNA replication proteins (R-HSA-4615885 )
Transcriptional regulation by small RNAs (R-HSA-5578749 )
Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC) (R-HSA-5619107 )
tRNA processing in the nucleus (R-HSA-6784531 )
HCMV Early Events (R-HSA-9609690 )
HCMV Late Events (R-HSA-9610379 )
SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
ISG15 antiviral mechanism (R-HSA-1169408 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Chromosomal disorder DISM5BB5 Definitive Biomarker [1]
Acute megakaryoblastic leukemia DIS0JX3M Strong Biomarker [2]
Acute myelomonocytic leukemia M4 DISRRMV2 Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Alzheimer disease DISF8S70 Strong Altered Expression [5]
Amyotrophic lateral sclerosis DISF7HVM Strong Biomarker [6]
Anemia DISTVL0C Strong Biomarker [7]
Astrocytoma DISL3V18 Strong Altered Expression [8]
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive DIS3KLUX Strong Genetic Variation [9]
Breast cancer DIS7DPX1 Strong Altered Expression [10]
Breast carcinoma DIS2UE88 Strong Altered Expression [10]
Childhood acute megakaryoblastic leukemia DIS5VZDR Strong Genetic Variation [11]
Chronic myelomonocytic leukemia DISIL8UR Strong Altered Expression [12]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [13]
Endometrial cancer DISW0LMR Strong Posttranslational Modification [14]
Endometrial carcinoma DISXR5CY Strong Posttranslational Modification [14]
Epilepsy DISBB28L Strong Genetic Variation [8]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [15]
Gastric cancer DISXGOUK Strong Biomarker [16]
Glioma DIS5RPEH Strong Altered Expression [17]
Haematological malignancy DISCDP7W Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [19]
leukaemia DISS7D1V Strong Genetic Variation [20]
Liver cancer DISDE4BI Strong Biomarker [21]
Lung cancer DISCM4YA Strong Altered Expression [22]
Lung carcinoma DISTR26C Strong Altered Expression [22]
Lymphoid leukemia DIS65TYQ Strong Biomarker [23]
Myelodysplastic syndrome DISYHNUI Strong Altered Expression [24]
Neoplasm DISZKGEW Strong Altered Expression [25]
Non-small-cell lung cancer DIS5Y6R9 Strong Genetic Variation [22]
Promyelocytic leukaemia DISYGG13 Strong Altered Expression [26]
Stomach cancer DISKIJSX Strong Biomarker [16]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [27]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Altered Expression [24]
Myeloid leukaemia DISMN944 moderate Genetic Variation [28]
Small lymphocytic lymphoma DIS30POX moderate Altered Expression [29]
Glioblastoma multiforme DISK8246 Disputed Altered Expression [30]
Acute leukaemia DISDQFDI Limited Biomarker [31]
Adult glioblastoma DISVP4LU Limited Altered Expression [30]
Childhood myelodysplastic syndrome DISMN80I Limited Altered Expression [32]
Chronic myelomonocytic leukaemia DISDN5P7 Limited Biomarker [12]
Leukemia DISNAKFL Limited Biomarker [33]
Myeloproliferative neoplasm DIS5KAPA Limited Biomarker [9]
Neuroblastoma DISVZBI4 Limited Genetic Variation [34]
Schizophrenia DISSRV2N Limited Altered Expression [35]
Triple negative breast cancer DISAMG6N Limited Altered Expression [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [36]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [37]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [38]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [39]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [40]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [41]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [46]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Nuclear pore complex protein Nup98-Nup96 (NUP98). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Nuclear pore complex protein Nup98-Nup96 (NUP98). [42]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Nuclear pore complex protein Nup98-Nup96 (NUP98). [43]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Nuclear pore complex protein Nup98-Nup96 (NUP98). [44]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Nuclear pore complex protein Nup98-Nup96 (NUP98). [45]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Nuclear pore complex protein Nup98-Nup96 (NUP98). [44]
------------------------------------------------------------------------------------

References

1 Identification of NUP98 abnormalities in acute leukemia: JARID1A (12p13) as a new partner gene.Genes Chromosomes Cancer. 2006 May;45(5):437-46. doi: 10.1002/gcc.20308.
2 Human models of NUP98-KDM5A megakaryocytic leukemia in mice contribute to uncovering new biomarkers and therapeutic vulnerabilities.Blood Adv. 2019 Nov 12;3(21):3307-3321. doi: 10.1182/bloodadvances.2019030981.
3 Additional acquisition of t(1;21)(p32;q22) in a patient relapsing with acute myelogenous leukemia with NUP98-HOXA9.Int J Hematol. 2008 Dec;88(5):571-574. doi: 10.1007/s12185-008-0198-9. Epub 2008 Nov 13.
4 Modulation of microRNA editing, expression and processing by ADAR2 deaminase in glioblastoma.Genome Biol. 2015 Jan 13;16(1):5. doi: 10.1186/s13059-014-0575-z.
5 Hippocampus-specific deficiency in RNA editing of GluA2 in Alzheimer's disease.Neurobiol Aging. 2014 Aug;35(8):1785-91. doi: 10.1016/j.neurobiolaging.2014.02.018. Epub 2014 Mar 1.
6 ADAR2 mislocalization and widespread RNA editing aberrations in C9orf72-mediated ALS/FTD.Acta Neuropathol. 2019 Jul;138(1):49-65. doi: 10.1007/s00401-019-01999-w. Epub 2019 Apr 3.
7 Analysis of hematopathology and alteration of JAK1/STAT3/STAT5 signaling axis in experimental myelodysplastic syndrome.Chem Biol Interact. 2016 Dec 25;260:176-185. doi: 10.1016/j.cbi.2016.10.010. Epub 2016 Oct 8.
8 ADAR RNA editing in human disease; more to it than meets the I.Hum Genet. 2017 Sep;136(9):1265-1278. doi: 10.1007/s00439-017-1837-0. Epub 2017 Sep 14.
9 NUP98-HOXA9-transgenic zebrafish develop a myeloproliferative neoplasm and provide new insight into mechanisms of myeloid leukaemogenesis.Br J Haematol. 2011 Oct;155(2):167-81. doi: 10.1111/j.1365-2141.2011.08810.x. Epub 2011 Aug 2.
10 NUP98 - a novel predictor of response to anthracycline-based chemotherapy in triple negative breast cancer.BMC Cancer. 2019 Apr 2;19(1):236. doi: 10.1186/s12885-019-5407-9.
11 NUP98-BPTF gene fusion identified in primary refractory acute megakaryoblastic leukemia of infancy.Genes Chromosomes Cancer. 2018 Jun;57(6):311-319. doi: 10.1002/gcc.22532. Epub 2018 Mar 28.
12 NUP98-HBO1-fusion generates phenotypically and genetically relevant chronic myelomonocytic leukemia pathogenesis.Blood Adv. 2019 Apr 9;3(7):1047-1060. doi: 10.1182/bloodadvances.2018025007.
13 The Secretion of miR-200s by a PKC/ADAR2 Signaling Axis Promotes Liver Metastasis in Colorectal Cancer.Cell Rep. 2018 Apr 24;23(4):1178-1191. doi: 10.1016/j.celrep.2018.03.118.
14 Metabolomic and Lipidomic Profiling Identifies The Role of the RNA Editing Pathway in Endometrial Carcinogenesis.Sci Rep. 2017 Aug 18;7(1):8803. doi: 10.1038/s41598-017-09169-2.
15 ADAR2 functions as a tumor suppressor via editing IGFBP7 in esophageal squamous cell carcinoma.Int J Oncol. 2017 Feb;50(2):622-630. doi: 10.3892/ijo.2016.3823. Epub 2016 Dec 29.
16 ADAR-Mediated RNA Editing Predicts Progression and Prognosis of Gastric Cancer.Gastroenterology. 2016 Oct;151(4):637-650.e10. doi: 10.1053/j.gastro.2016.06.043. Epub 2016 Jul 1.
17 Aberrant alternative splicing pattern of ADAR2 downregulates adenosine-to-inosine editing in glioma.Oncol Rep. 2015 Jun;33(6):2845-52. doi: 10.3892/or.2015.3907. Epub 2015 Apr 8.
18 Function of Nup98 subtypes and their fusion proteins, Nup98-TopII and Nup98-SETBP1 in nuclear-cytoplasmic transport.Biochem Biophys Res Commun. 2017 May 20;487(1):96-102. doi: 10.1016/j.bbrc.2017.04.024. Epub 2017 Apr 7.
19 A disrupted RNA editing balance mediated by ADARs (Adenosine DeAminases that act on RNA) in human hepatocellular carcinoma.Gut. 2014 May;63(5):832-43. doi: 10.1136/gutjnl-2012-304037. Epub 2013 Jun 13.
20 A unique mutator phenotype reveals complementary oncogenic lesions leading to acute leukemia.JCI Insight. 2019 Dec 5;4(23):e131434. doi: 10.1172/jci.insight.131434.
21 ADAR2-mediated editing of miR-214 and miR-122 precursor and antisense RNA transcripts in liver cancers.PLoS One. 2013 Dec 27;8(12):e81922. doi: 10.1371/journal.pone.0081922. eCollection 2013.
22 Identification of novel deregulated RNA metabolism-related genes in non-small cell lung cancer.PLoS One. 2012;7(8):e42086. doi: 10.1371/journal.pone.0042086. Epub 2012 Aug 2.
23 NUP98/11p15 translocations affect CD34+ cells in myeloid and T lymphoid leukemias.Leuk Res. 2015 Jul;39(7):769-72. doi: 10.1016/j.leukres.2015.04.014. Epub 2015 May 7.
24 The NUP98-HOXD13 fusion oncogene induces thymocyte self-renewal via Lmo2/Lyl1.Leukemia. 2019 Aug;33(8):1868-1880. doi: 10.1038/s41375-018-0361-0. Epub 2019 Jan 30.
25 Adenosine Deaminase That Acts on RNA 3 (ADAR3) Binding to Glutamate Receptor Subunit B Pre-mRNA Inhibits RNA Editing in Glioblastoma.J Biol Chem. 2017 Mar 10;292(10):4326-4335. doi: 10.1074/jbc.M117.779868. Epub 2017 Feb 6.
26 Critical role of retinoid/rexinoid signaling in mediating transformation and therapeutic response of NUP98-RARG leukemia.Leukemia. 2015 May;29(5):1153-62. doi: 10.1038/leu.2014.334. Epub 2014 Dec 16.
27 Altered editing in RNA editing adenosine deaminase ADAR2 gene transcripts of systemic lupus erythematosus T lymphocytes.Immunology. 2007 Jul;121(3):359-69. doi: 10.1111/j.1365-2567.2007.02582.x. Epub 2007 Mar 22.
28 A new fusion gene NUP98-IQCG identified in an acute T-lymphoid/myeloid leukemia with a t(3;11)(q29q13;p15)del(3)(q29) translocation.Oncogene. 2008 May 29;27(24):3414-23. doi: 10.1038/sj.onc.1210999. Epub 2007 Dec 17.
29 NUP98-PHF23 is a chromatin-modifying oncoprotein that causes a wide array of leukemias sensitive to inhibition of PHD histone reader function.Cancer Discov. 2014 May;4(5):564-77. doi: 10.1158/2159-8290.CD-13-0419. Epub 2014 Feb 17.
30 ADARs and editing: The role of A-to-I RNA modification in cancer progression.Semin Cell Dev Biol. 2018 Jul;79:123-130. doi: 10.1016/j.semcdb.2017.11.018. Epub 2017 Nov 16.
31 Use of Hematopoietic Stem Cell Transplantation to Assess the Origin of Myelodysplastic Syndrome.J Vis Exp. 2018 Oct 3;(140):58140. doi: 10.3791/58140.
32 Knock-in of a FLT3/ITD mutation cooperates with a NUP98-HOXD13 fusion to generate acute myeloid leukemia in a mouse model.Blood. 2012 Mar 22;119(12):2883-94. doi: 10.1182/blood-2011-10-382283. Epub 2012 Feb 8.
33 Thymic precursor cells generate acute myeloid leukemia in NUP98-PHF23/NUP98-HOXD13 double transgenic mice.Sci Rep. 2019 Nov 20;9(1):17213. doi: 10.1038/s41598-019-53610-7.
34 Chromosome t(7;11)(p15;p15) translocation in acute myeloid leukemia coexisting with multilineage dyspoiesis and mutations in NRAS and WT1: A case report and literature review.Oncol Lett. 2017 May;13(5):3066-3070. doi: 10.3892/ol.2017.5823. Epub 2017 Mar 7.
35 A role of ADAR2 and RNA editing of glutamate receptors in mood disorders and schizophrenia.Mol Brain. 2014 Jan 21;7:5. doi: 10.1186/1756-6606-7-5.
36 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
37 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
38 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
39 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
40 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
41 Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
43 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
44 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
45 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
46 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
47 [Effect of deguelin on expression of nup98 in K562 cells]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2007 Feb;15(1):25-8.