General Information of Drug Off-Target (DOT) (ID: OTP4HSHG)

DOT Name Integrin beta-8 (ITGB8)
Gene Name ITGB8
UniProt ID
ITB8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6DJP; 6OM1; 6OM2; 6UJA; 6UJB; 6UJC; 7Y1T; 8TCF
Pfam ID
PF07974 ; PF00362 ; PF17205
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Function
Integrin alpha-V:beta-8 (ITGAV:ITGB8) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligands. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation on the surface of activated regulatory T-cells (Tregs) (Probable). Required during vasculogenesis.
Tissue Specificity Placenta, kidney, brain, ovary, uterus and in several transformed cells. Transiently expressed in 293 human embryonic kidney cells.
KEGG Pathway
PI3K-Akt sig.ling pathway (hsa04151 )
Focal adhesion (hsa04510 )
ECM-receptor interaction (hsa04512 )
Cell adhesion molecules (hsa04514 )
Regulation of actin cytoskeleton (hsa04810 )
Cytoskeleton in muscle cells (hsa04820 )
Human papillomavirus infection (hsa05165 )
Hypertrophic cardiomyopathy (hsa05410 )
Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
Dilated cardiomyopathy (hsa05414 )
Reactome Pathway
Integrin cell surface interactions (R-HSA-216083 )
TGF-beta receptor signaling activates SMADs (R-HSA-2173789 )
Molecules associated with elastic fibres (R-HSA-2129379 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Integrin beta-8 (ITGB8). [1]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Integrin beta-8 (ITGB8). [2]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Integrin beta-8 (ITGB8). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Integrin beta-8 (ITGB8). [4]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Integrin beta-8 (ITGB8). [5]
Triclosan DMZUR4N Approved Triclosan increases the expression of Integrin beta-8 (ITGB8). [6]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Integrin beta-8 (ITGB8). [7]
Progesterone DMUY35B Approved Progesterone affects the expression of Integrin beta-8 (ITGB8). [8]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Integrin beta-8 (ITGB8). [9]
Malathion DMXZ84M Approved Malathion increases the expression of Integrin beta-8 (ITGB8). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Integrin beta-8 (ITGB8). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Integrin beta-8 (ITGB8). [12]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Integrin beta-8 (ITGB8). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Integrin beta-8 (ITGB8). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Integrin beta-8 (ITGB8). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Integrin beta-8 (ITGB8). [9]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Integrin beta-8 (ITGB8). [16]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Integrin beta-8 (ITGB8). [17]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of Integrin beta-8 (ITGB8). [18]
(E)-4-(3,5-dimethoxystyryl)phenol DMYXI2V Investigative (E)-4-(3,5-dimethoxystyryl)phenol decreases the expression of Integrin beta-8 (ITGB8). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
6 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
7 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
8 Perfluorooctanoic acid alters progesterone activity in human endometrial cells and induces reproductive alterations in young women. Chemosphere. 2020 Mar;242:125208. doi: 10.1016/j.chemosphere.2019.125208. Epub 2019 Oct 24.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
10 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
13 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
14 Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
15 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
16 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
17 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
18 Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
19 Genomic analysis of pterostilbene predicts its antiproliferative effects against pancreatic cancer in vitro and in vivo. J Gastrointest Surg. 2012 Jun;16(6):1136-43. doi: 10.1007/s11605-012-1869-7. Epub 2012 Mar 27.