Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQA7Z5H)

DOT Name Cotranscriptional regulator ARB2A (ARB2A)
Synonyms ARB2 cotranscriptional regulator A; Cotranscriptional regulator FAM172A; Protein FAM172A
Gene Name ARB2A
UniProt ID
ARB2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09757
Sequence
MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTL
EGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLK
KVSIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQ
IPFIKRAVAEGYGVIVLNPNENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKR
RDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESM
LPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL
Function
Plays a role in the regulation of alternative splicing, by interacting with AGO2 and CHD7. Seems to be required for stabilizing protein-protein interactions at the chromatin-spliceosome interface. May have hydrolase activity.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Cotranscriptional regulator ARB2A (ARB2A). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Cotranscriptional regulator ARB2A (ARB2A). [5]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [6]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Cotranscriptional regulator ARB2A (ARB2A). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [9]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin increases the expression of Cotranscriptional regulator ARB2A (ARB2A). [10]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Cotranscriptional regulator ARB2A (ARB2A). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
10 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
11 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.