Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQB4H1J)

DOT Name Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3)
Synonyms Development and differentiation-enhancing factor-like 1; Protein up-regulated in liver cancer 1
Gene Name ASAP3
UniProt ID
ASAP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2B0O; 3LVQ; 3LVR
Pfam ID
PF12796 ; PF01412 ; PF16746 ; PF00169
Sequence
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD
Function Promotes cell proliferation.
Tissue Specificity Highly expressed in primary hepatocarcinoma. Detected in lung, liver and blood leukocytes.
KEGG Pathway
Endocytosis (hsa04144 )
Fc gamma R-mediated phagocytosis (hsa04666 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [1]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [10]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [12]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [5]
Selenium DM25CGV Approved Selenium increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [6]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [8]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [9]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 (ASAP3). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
8 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
9 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.