Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQMCR8C)

• DOT Name: Protein FAM200B (FAM200B)
• Gene Name: FAM200B
• UniProt ID: F200B_HUMAN
• Sequence:
  MDHFFIKRKRNSEVKYTEACSSSSVESGIVNSDNIEKNTDSNLQTSTSFEPHFKKKKVSA
  RRYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLE
  YFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVR
  TIFDDKSADKLKTIPNDNTVSLRICTIAEHLETMLITRLQSGIDFAIQLDESTDIGSCTT
  LLVYVRYAWQDDFLEDFLCFLNLTSHLSGLDIFTELERRIVGQYKLNWKNCKGITSDGTA
  TMTGKHSRVIKKLLEVTNNGAVWNHCFIHREGLASREIPQNLMEVLKNAVKVVNFIKGSS
  LNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIF
  EDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPS
  YYMFPRFLQHIEENIINENILKEIKLEILLHLTSLSQTFNHFFPEEKFETLRENSWVKDP
  FAFRHPESIIELNLVPEEENELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVL
  LLLPFTTTSLCELGFSILTQLKTKERNGLNCAAVMRVALSSCVPDWNELMNRQAHPS

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein FAM200B (FAM200B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein FAM200B (FAM200B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein FAM200B (FAM200B).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein FAM200B (FAM200B).	[4]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Protein FAM200B (FAM200B).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein FAM200B (FAM200B).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein FAM200B (FAM200B).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein FAM200B (FAM200B).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein FAM200B (FAM200B).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.