Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU0RGB0)

• DOT Name: Failed axon connections homolog (FAXC)
• Gene Name: FAXC
• UniProt ID: FAXC_HUMAN
• Pfam ID: PF19333 ; PF17171 ; PF17172
• Sequence:
  MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSD
  PWWKKTLYLTGGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCL
  KMETYLRMADLPYQNYFGGKLSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLG
  PHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKG
  IVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAM
  WTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSEGSKTHTPLLD
  FSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK
• Function: May play a role in axonal development.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Failed axon connections homolog (FAXC).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Failed axon connections homolog (FAXC).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Failed axon connections homolog (FAXC).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Failed axon connections homolog (FAXC).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Failed axon connections homolog (FAXC).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of Failed axon connections homolog (FAXC).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Failed axon connections homolog (FAXC).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Failed axon connections homolog (FAXC).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Failed axon connections homolog (FAXC).	[9]
Propanoic Acid	DM9TN2W	Investigative	Propanoic Acid decreases the expression of Failed axon connections homolog (FAXC).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Failed axon connections homolog (FAXC).	[7]

References

• [1] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Propionic acid induces mitochondrial dysfunction and affects gene expression for mitochondria biogenesis and neuronal differentiation in SH-SY5Y cell line. Neurotoxicology. 2019 Dec;75:116-122. doi: 10.1016/j.neuro.2019.09.009. Epub 2019 Sep 14.