Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW5MKC1)

• DOT Name: RNA-binding region-containing protein 3 (RNPC3)
• Synonyms: RNA-binding motif protein 40; RNA-binding protein 40; U11/U12 small nuclear ribonucleoprotein 65 kDa protein; U11/U12 snRNP 65 kDa protein; U11/U12-65K
• Gene Name: RNPC3
• Related Disease:
  Isolated growth hormone deficiency, type 5
  Advanced cancer
  Ataxia-telangiectasia
  Autoimmune hepatitis
  C1Q deficiency
  Connective tissue disorder
  Depression
  Dermatomyositis
  Dyskeratosis congenita
  Familial Mediterranean fever
  Glomerulonephritis
  Hantavirus infection
  Idiopathic inflammatory myopathy
  Influenza
  Leukopenia
  Mixed connective tissue disease
  Neoplasm
  Non-insulin dependent diabetes
  Pulmonary arterial hypertension
  Sjogren syndrome
  Thrombocytopenia
  High blood pressure
  Lupus
  Spinal muscular atrophy
  Isolated growth hormone deficiency type IA
  Arthritis
  Nematode infection
  Pituitary dwarfism
  Type-1/2 diabetes
• UniProt ID: RNPC3_HUMAN
• PDB ID: 3EGN; 5OBN
• Pfam ID: PF00076
• Sequence:
  MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYFGAQSVRVLSD
  KGRLKHTAFATFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDRVHSPCPTSGSEKKKR
  SDDPVEDDKEKKELGYLTVENGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVP
  KFYVQVLHLMNKMNLPTPFGPITARPPMYEDYMPLHAPLPPTSPQPPEEPPLPDEDEELS
  SEESEYESTDDEDRQRMNKLMELANLQPKRPKTIKQRHVRKKRKIKDMLNTPLCPSHSSL
  HPVLLPSDVFDQPQPVGNKRIEFHISTDMPAAFKKDLEKEQNCEEKNHDLPATEVDASNI
  GFGKIFPKPNLDITEEIKEDSDEMPSECISRRELEKGRISREEMETLSVFRSYEPGEPNC
  RIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAA
  KALKEANGYVLFGKPMVVQFARSARPKQDPKEGKRKC
• Function: Participates in pre-mRNA U12-dependent splicing, performed by the minor spliceosome which removes U12-type introns. U12-type introns comprises less than 1% of all non-coding sequences. Binds to the 3'-stem-loop of m(7)G-capped U12 snRNA.
• Tissue Specificity: Highly expressed in pancreas and kidney. Detected at lower levels in heart, brain, placenta, lung, liver, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes.
• Reactome Pathway: mRNA Splicing - Minor Pathway (R-HSA-72165)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Isolated growth hormone deficiency, type 5	DISVY7CR	Definitive	Autosomal recessive	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Ataxia-telangiectasia	DISP3EVR	Strong	Biomarker	[3]
Autoimmune hepatitis	DISOX03Q	Strong	Biomarker	[4]
C1Q deficiency	DISWV4KU	Strong	Biomarker	[5]
Connective tissue disorder	DISKXBS3	Strong	Biomarker	[6]
Depression	DIS3XJ69	Strong	Biomarker	[7]
Dermatomyositis	DIS50C5O	Strong	Biomarker	[8]
Dyskeratosis congenita	DISSXV0K	Strong	Biomarker	[9]
Familial Mediterranean fever	DISVP5WP	Strong	Genetic Variation	[10]
Glomerulonephritis	DISPZIQ3	Strong	Biomarker	[11]
Hantavirus infection	DISZFTMH	Strong	Biomarker	[12]
Idiopathic inflammatory myopathy	DISGB1BZ	Strong	Biomarker	[13]
Influenza	DIS3PNU3	Strong	Biomarker	[14]
Leukopenia	DISJMBMM	Strong	Biomarker	[15]
Mixed connective tissue disease	DISXX0H8	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Altered Expression	[16]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[17]
Pulmonary arterial hypertension	DISP8ZX5	Strong	Biomarker	[18]
Sjogren syndrome	DISUBX7H	Strong	Biomarker	[19]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[15]
High blood pressure	DISY2OHH	moderate	Biomarker	[20]
Lupus	DISOKJWA	moderate	Biomarker	[21]
Spinal muscular atrophy	DISTLKOB	moderate	Biomarker	[22]
Isolated growth hormone deficiency type IA	DISLPIAM	Supportive	Autosomal recessive	[23]
Arthritis	DIST1YEL	Limited	Genetic Variation	[24]
Nematode infection	DISVFLRK	Limited	Biomarker	[25]
Pituitary dwarfism	DISI019B	Limited	Genetic Variation	[26]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[27]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of RNA-binding region-containing protein 3 (RNPC3).	[28]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of RNA-binding region-containing protein 3 (RNPC3).	[31]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of RNA-binding region-containing protein 3 (RNPC3).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of RNA-binding region-containing protein 3 (RNPC3).	[35]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of RNA-binding region-containing protein 3 (RNPC3).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA-binding region-containing protein 3 (RNPC3).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of RNA-binding region-containing protein 3 (RNPC3).	[32]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of RNA-binding region-containing protein 3 (RNPC3).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of RNA-binding region-containing protein 3 (RNPC3).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of RNA-binding region-containing protein 3 (RNPC3).	[36]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of RNA-binding region-containing protein 3 (RNPC3).	[37]

References

• [1] Establishing intellectual disability as the key feature of patients with biallelic RNPC3 variants. Am J Med Genet A. 2021 Jun;185(6):1836-1840. doi: 10.1002/ajmg.a.62152. Epub 2021 Mar 1.
• [2] Brief Report: Anti-RNPC-3 Antibodies As a Marker of Cancer-Associated Scleroderma.Arthritis Rheumatol. 2017 Jun;69(6):1306-1312. doi: 10.1002/art.40065.
• [3] HIGH PREVALENCE OF HYPOTHYROIDISM IN SYSTEMIC LUPUS ERYTHEMATOSUS PATIENTS WITHOUT AN INCREASE IN CIRCULATING ANTI-THYROID ANTIBODIES.Endocr Pract. 2017 Nov;23(11):1304-1310. doi: 10.4158/EP161664.OR. Epub 2017 Aug 17.
• [4] Anti-tRNP(ser)sec/SLA/LP autoantibodies. Comparative study using in-house ELISA with a recombinant 48.8 kDa protein, immunoblot, and analysis of immunoprecipitated RNAs.Liver Int. 2005 Apr;25(2):410-9. doi: 10.1111/j.1478-3231.2005.01079.x.
• [5] Hereditary C1q deficiency and systemic lupus erythematosus.QJM. 1994 Aug;87(8):455-64.
• [6] Congenital heart block and subsequent connective tissue disorder in adolescence.Lupus. 1997;6(3):283-4. doi: 10.1177/096120339700600313.
• [7] The burden of depression in systemic sclerosis patients: a nationwide population-based study.J Affect Disord. 2019 Jan 15;243:427-431. doi: 10.1016/j.jad.2018.09.075. Epub 2018 Sep 21.
• [8] Facts and controversies in mixed connective tissue disease.Med Clin (Barc). 2018 Jan 12;150(1):26-32. doi: 10.1016/j.medcli.2017.06.066. Epub 2017 Aug 31.
• [9] Very short telomeres in the peripheral blood of patients with X-linked and autosomal dyskeratosis congenita.Blood Cells Mol Dis. 2001 Mar-Apr;27(2):353-7. doi: 10.1006/bcmd.2001.0389.
• [10] Determination of autoantibodies in patients with familial Mediterranean fever and their first degree relatives.J Rheumatol. 1991 Apr;18(4):606-8.
• [11] T cell vaccination therapy in an induced model of anti-RNP autoimmune glomerulonephritis.Clin Immunol. 2010 Nov;137(2):281-7. doi: 10.1016/j.clim.2010.07.013. Epub 2010 Aug 24.
• [12] Genetic properties of medium (M) and small (S) genomic RNA segments of Seoul hantavirus isolated from Rattus norvegicus and antigenicity analysis of recombinant nucleocapsid protein.Virus Genes. 2007 Jan;34(1):23-30. doi: 10.1007/s11262-006-0005-8. Epub 2006 Aug 22.
• [13] Immunoglobulin gene polymorphisms are susceptibility factors in clinical and autoantibody subgroups of the idiopathic inflammatory myopathies.Arthritis Rheum. 2008 Oct;58(10):3239-46. doi: 10.1002/art.23899.
• [14] Inhibition of Influenza A Virus Replication by TRIM14 via Its Multifaceted Protein-Protein Interaction With NP.Front Microbiol. 2019 Feb 26;10:344. doi: 10.3389/fmicb.2019.00344. eCollection 2019.
• [15] The clinical significance of antinuclear antibodies and specific autoantibodies in juvenile and adult systemic lupus erythematosus patients.Asian Pac J Allergy Immunol. 2021 Dec;39(4). doi: 10.12932/AP-211218-0465.
• [16] Long interspersed element-1 ribonucleoprotein particles protect telomeric ends in alternative lengthening of telomeres dependent cells.Neoplasia. 2020 Feb;22(2):61-75. doi: 10.1016/j.neo.2019.11.002. Epub 2019 Dec 14.
• [17] Lecithin nano-liposomal particle as a CRISPR/Cas9 complex delivery system for treating type 2 diabetes.J Nanobiotechnology. 2019 Jan 29;17(1):19. doi: 10.1186/s12951-019-0452-8.
• [18] The impact of anti-U1-RNP positivity: systemic lupus erythematosus versus mixed connective tissue disease.Rheumatol Int. 2018 Jul;38(7):1169-1178. doi: 10.1007/s00296-018-4059-4. Epub 2018 May 23.
• [19] Hypocomplementaemic urticarial vasculitis, angio-oedema and 'lupus-like' disease: association with C4B null allele.Clin Exp Rheumatol. 1987 Apr-Jun;5(2):161-4.
• [20] Prevalence of auto-antibodies associated to pulmonary arterial hypertension in scleroderma - A review.Autoimmun Rev. 2018 Dec;17(12):1186-1201. doi: 10.1016/j.autrev.2018.06.009. Epub 2018 Oct 12.
• [21] Associations Between Classification Criteria Items in Systemic Lupus Erythematosus.Arthritis Care Res (Hoboken). 2020 Dec;72(12):1820-1826. doi: 10.1002/acr.24078. Epub 2020 Nov 7.
• [22] SECIS-binding protein 2 interacts with the SMN complex and the methylosome for selenoprotein mRNP assembly and translation.Nucleic Acids Res. 2017 May 19;45(9):5399-5413. doi: 10.1093/nar/gkx031.
• [23] Defective minor spliceosome mRNA processing results in isolated familial growth hormone deficiency. EMBO Mol Med. 2014 Mar;6(3):299-306. doi: 10.1002/emmm.201303573. Epub 2014 Jan 30.
• [24] Estrogen receptor alpha gene ( ESR1) polymorphism can contribute to clinical findings in systemic lupus erythematosus patients.Lupus. 2017 Mar;26(3):294-298. doi: 10.1177/0961203316668041. Epub 2016 Sep 29.
• [25] Enhanced Genome Editing with Cas9 Ribonucleoprotein in Diverse Cells and Organisms.J Vis Exp. 2018 May 25;(135):57350. doi: 10.3791/57350.
• [26] Mutations in the U11/U12-65K protein associated with isolated growth hormone deficiency lead to structural destabilization and impaired binding of U12 snRNA.RNA. 2018 Mar;24(3):396-409. doi: 10.1261/rna.062844.117. Epub 2017 Dec 18.
• [27] Survival and prognostic factors in patients with connective tissue disease-associated pulmonary hypertension diagnosed by echocardiography: results from a Korean nationwide registry.Int J Rheum Dis. 2017 Sep;20(9):1227-1236. doi: 10.1111/1756-185X.12645. Epub 2015 Jul 27.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [34] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [35] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [36] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [37] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.