Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWRWYVK)

• DOT Name: Placenta-specific protein 1 (PLAC1)
• Gene Name: PLAC1
• UniProt ID: PLAC1_HUMAN
• Pfam ID: PF00100
• Sequence:
  MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLG
  CPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQK
  SPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQ
  AGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
• Function: May play a role in placental development.
• Tissue Specificity: Expressed in placenta. Localizes primarily to differentiated syncytiotrophoblast throughout gestation as well as to a small population of villous cytotrophoblasts. Also detected in maternal blood and rapidly disappears following delivery, but is not detected in other adult or fetal tissues examined.

Molecular Interaction Atlas (MIA) of This DOT

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Placenta-specific protein 1 (PLAC1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Placenta-specific protein 1 (PLAC1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Placenta-specific protein 1 (PLAC1).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Placenta-specific protein 1 (PLAC1).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Placenta-specific protein 1 (PLAC1).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Placenta-specific protein 1 (PLAC1).	[6]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Placenta-specific protein 1 (PLAC1).	[5]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Placenta-specific protein 1 (PLAC1).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Placenta-specific protein 1 (PLAC1).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Placenta-specific protein 1 (PLAC1).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Placenta-specific protein 1 (PLAC1).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Placenta-specific protein 1 (PLAC1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Placenta-specific protein 1 (PLAC1).	[12]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Placenta-specific protein 1 (PLAC1).	[13]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Placenta-specific protein 1 (PLAC1).	[14]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Placenta-specific protein 1 (PLAC1).	[15]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [4] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [5] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [13] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [15] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.