Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTX580VU)
| DOT Name | CD302 antigen (CD302) | ||||
|---|---|---|---|---|---|
| Synonyms | C-type lectin BIMLEC; C-type lectin domain family 13 member A; DEC205-associated C-type lectin 1; Type I transmembrane C-type lectin receptor DCL-1; CD antigen CD302 | ||||
| Gene Name | CD302 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                            MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHG 
                        
                    ADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD DEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTV ILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFD  | 
            ||||
| Function | Potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration. | ||||
| Tissue Specificity | 
                                         
                        Expressed at moderate levels in monocytes, myeloid blood dendritic cells and granulocytes and at low levels in plasmacytoid blood dendritic cells, monocyte-derived ma crophages and monocyte-derived dendritic cells, with no expression detected in T-lymphocytes, B-lymphocytes and natural killer cells (at protein level). Expressed widely in different tissues, with highest expression levels in liver, lung, peripheral blood leukocytes and spleen, and lowest levels in neuronal tissues, skeletal muscle and ovary. Isoform 2 and isoform 3 are expressed in malignant Hodgkin lymphoma cells called Hodgkin and Reed-Sternberg (HRS) cells.
                        
                     
                                     | 
            ||||
Molecular Interaction Atlas (MIA) of This DOT
| 
                     6 Disease(s) Related to This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     This DOT Affected the Drug Response of 1 Drug(s) 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 
                     17 Drug(s) Affected the Gene/Protein Processing of This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
