Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY3IJK5)

• DOT Name: Protein SNORC (SNORC)
• Synonyms: Secondary ossification center-associated regulator of chondrocyte maturation protein
• Gene Name: SNORC
• Related Disease:
  Attention deficit hyperactivity disorder
  Schizophrenia
• UniProt ID: SNORC_HUMAN
• Pfam ID: PF15756
• Sequence:
  MASCLALRMALLLVSGVLAPAVLTDDVPQEPVPTLWNEPAELPSGEGPVESTSPGREPVD
  TGPPAPTVAPGPEDSTAQERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSA
  S
• Function: Plays a role in the regulation of chondrocyte maturation and postnatal endochondral ossification. May inhibit cell growth stimulation induced by FGF2.
• Tissue Specificity: Expressed in cartilage.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[1]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[2]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein SNORC (SNORC).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein SNORC (SNORC).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein SNORC (SNORC).	[5]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Protein SNORC (SNORC).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein SNORC (SNORC).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Protein SNORC (SNORC).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein SNORC (SNORC).	[9]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Protein SNORC (SNORC).	[11]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein SNORC (SNORC).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein SNORC (SNORC).	[13]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Protein SNORC (SNORC).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Protein SNORC (SNORC).	[10]

References

• [1] Exploring genetic variation that influences brain methylation in attention-deficit/hyperactivity disorder.Transl Psychiatry. 2019 Oct 3;9(1):242. doi: 10.1038/s41398-019-0574-7.
• [2] Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.