Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY7BSD7)

DOT Name Tubulointerstitial nephritis antigen (TINAG)
Synonyms TIN-Ag
Gene Name TINAG
Related Disease
Interstitial nephritis ( )
Nephronophthisis ( )
Nephronophthisis 1 ( )
Chronic kidney disease ( )
Chronic renal failure ( )
End-stage renal disease ( )
Diabetic kidney disease ( )
Hepatocellular carcinoma ( )
UniProt ID
TINAG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00112
Sequence
MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNF
GCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGC
FKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRSELIEQVNKGDYGWTAQNYSQFW
GMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSN
ETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP
Function Mediates adhesion of proximal tubule epithelial cells via integrins alpha3-beta1 and alphaV-beta3. This is a non catalytic peptidase C1 family protein.
Tissue Specificity Expressed in the kidney cortex, small intestine and cornea.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Interstitial nephritis DISKQGND Strong Biomarker [1]
Nephronophthisis DISXU4HY Strong Biomarker [1]
Nephronophthisis 1 DIS7QNQ3 Strong Biomarker [1]
Chronic kidney disease DISW82R7 moderate Genetic Variation [2]
Chronic renal failure DISGG7K6 moderate Genetic Variation [2]
End-stage renal disease DISXA7GG moderate Genetic Variation [2]
Diabetic kidney disease DISJMWEY Limited Biomarker [3]
Hepatocellular carcinoma DIS0J828 Limited Altered Expression [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Tubulointerstitial nephritis antigen (TINAG). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Tubulointerstitial nephritis antigen (TINAG). [10]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Tubulointerstitial nephritis antigen (TINAG). [6]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Tubulointerstitial nephritis antigen (TINAG). [7]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Tubulointerstitial nephritis antigen (TINAG). [8]
Cidofovir DMA13GD Approved Cidofovir decreases the expression of Tubulointerstitial nephritis antigen (TINAG). [6]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Tubulointerstitial nephritis antigen (TINAG). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Tubulointerstitial nephritis antigen (TINAG). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Tubulointerstitial nephritis antigen (TINAG). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Molecular cloning, expression, and chromosomal localization of a human tubulointerstitial nephritis antigen.Biochem Biophys Res Commun. 2000 Feb 5;268(1):225-30. doi: 10.1006/bbrc.2000.2103.
2 A tubulointerstitial nephritis antigen gene defect causes childhood-onset chronic renal failure.Pediatr Nephrol. 2010 Jul;25(7):1349-53. doi: 10.1007/s00467-010-1463-8. Epub 2010 Feb 16.
3 Quantitative proteomic profiling identifies new renal targets of copper(II)-selective chelation in the reversal of diabetic nephropathy in rats.Proteomics. 2009 Sep;9(18):4309-20. doi: 10.1002/pmic.200900285.
4 Activation of PI3K/AKT is involved in TINAG-mediated promotion of proliferation, invasion and migration of hepatocellular carcinoma.Cancer Biomark. 2018;23(1):33-43. doi: 10.3233/CBM-181277.
5 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
7 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
8 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
9 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.