Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYIDK1T)

• DOT Name: Adipose-secreted signaling protein (ADISSP)
• Gene Name: ADISSP
• UniProt ID: ADSSP_HUMAN
• Pfam ID: PF15006
• Sequence:
  MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKI
  LHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEI
  LLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD
• Function: Adipocyte-secreted protein (adipokine) that acts as a key regulator for white adipose tissue (WAT) thermogenesis and glucose homeostasis at least in part through activation of protein kinase A (PKA).

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Adipose-secreted signaling protein (ADISSP).	[1]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Adipose-secreted signaling protein (ADISSP).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Adipose-secreted signaling protein (ADISSP).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Adipose-secreted signaling protein (ADISSP).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Adipose-secreted signaling protein (ADISSP).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Adipose-secreted signaling protein (ADISSP).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Adipose-secreted signaling protein (ADISSP).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Adipose-secreted signaling protein (ADISSP).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Adipose-secreted signaling protein (ADISSP).	[8]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Adipose-secreted signaling protein (ADISSP).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Adipose-secreted signaling protein (ADISSP).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [10] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.