Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYQ9ECW)

• DOT Name: Teashirt homolog 1 (TSHZ1)
• Synonyms: Antigen NY-CO-33; Serologically defined colon cancer antigen 33
• Gene Name: TSHZ1
• Related Disease:
  Lung adenocarcinoma
  Abdominal aortic aneurysm
  Alzheimer disease
  Amyloidosis
  Amyotrophic lateral sclerosis
  Aortic aneurysm
  Attention deficit hyperactivity disorder
  Breast cancer
  Breast carcinoma
  Cerebellar ataxia
  Colorectal carcinoma
  Congenital vertical talus
  Dementia
  Dilated cardiomyopathy 1A
  Endometrial cancer
  Endometrial carcinoma
  Endometriosis
  Familial prostate carcinoma
  Gerstmann-Straussler-Scheinker syndrome
  Glioblastoma multiforme
  Graves disease
  Hepatocellular carcinoma
  Huntington disease
  Idiopathic thrombocytopenic purpura
  Kallmann syndrome
  Malignant peripheral nerve sheath tumor
  Melanoma
  Panic disorder
  Prostate cancer, hereditary, 1
  Spinocerebellar ataxia
  Spinocerebellar ataxia type 2
  Thyroid gland follicular carcinoma
  Type-1/2 diabetes
  Uterine fibroids
  Ventricular septal defect
  Advanced cancer
  Age-related macular degeneration
  Clear cell renal carcinoma
  Methicillin-resistant staphylococci infection
  Aural atresia, congenital
  High blood pressure
  Lewy body dementia
  Meniere disease
  Neoplasm
  Non-insulin dependent diabetes
  Spinocerebellar ataxia type 17
• UniProt ID: TSH1_HUMAN
• Sequence:
  MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQ
  NSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVY
  ANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCS
  SSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVF
  TGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKRWSKPRKRSLMEMEGK
  EDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPSTKKRALQDLA
  PPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME
  CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPA
  SSIKKQPDSPAGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREED
  LDDSPKGGLDILKSLENTVSTAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQ
  VQPSYAGGVKSLSSAEHNALLHSPGSLTPPPHKSNVSAMEELVEKVTGKVNIKKEERPPE
  KEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLK
  AKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDPLAMLYKISNS
  MLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI
  SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLIL
  QAQFASSLRETTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFL
  KNLDTGHPVFFCNDCASQFRTASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTN
  KTLGPLGATEEDLGSTFQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLIYVTELEKQ
• Function: Probable transcriptional regulator involved in developmental processes. May act as a transcriptional repressor (Potential).
• Tissue Specificity: Expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Genetic Variation	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Genetic Variation	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Amyloidosis	DISHTAI2	Strong	Biomarker	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[5]
Aortic aneurysm	DISQ5KRA	Strong	Genetic Variation	[2]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[6]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[7]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[7]
Cerebellar ataxia	DIS9IRAV	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[9]
Congenital vertical talus	DISZF3HD	Strong	Biomarker	[10]
Dementia	DISXL1WY	Strong	Biomarker	[11]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[12]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[9]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[9]
Endometriosis	DISX1AG8	Strong	Genetic Variation	[13]
Familial prostate carcinoma	DISL9KNO	Strong	Biomarker	[14]
Gerstmann-Straussler-Scheinker syndrome	DISIO6KC	Strong	Genetic Variation	[15]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[16]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[18]
Huntington disease	DISQPLA4	Strong	Biomarker	[19]
Idiopathic thrombocytopenic purpura	DISFKGJU	Strong	Genetic Variation	[20]
Kallmann syndrome	DISO3HDG	Strong	Altered Expression	[21]
Malignant peripheral nerve sheath tumor	DIS0JTN6	Strong	Genetic Variation	[22]
Melanoma	DIS1RRCY	Strong	Genetic Variation	[23]
Panic disorder	DISD3VNY	Strong	Genetic Variation	[24]
Prostate cancer, hereditary, 1	DISE2P4L	Strong	Biomarker	[14]
Spinocerebellar ataxia	DISYMHUK	Strong	Biomarker	[25]
Spinocerebellar ataxia type 2	DISF7WDI	Strong	Genetic Variation	[26]
Thyroid gland follicular carcinoma	DISFK2QT	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
Uterine fibroids	DISBZRMJ	Strong	Genetic Variation	[18]
Ventricular septal defect	DISICO41	Strong	Genetic Variation	[29]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[30]
Age-related macular degeneration	DIS0XS2C	moderate	Genetic Variation	[31]
Clear cell renal carcinoma	DISBXRFJ	moderate	Genetic Variation	[32]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[33]
Aural atresia, congenital	DISCP7UV	Limited	Autosomal dominant	[34]
High blood pressure	DISY2OHH	Limited	Biomarker	[11]
Lewy body dementia	DISAE66J	Limited	Genetic Variation	[11]
Meniere disease	DISC5R5F	Limited	Genetic Variation	[35]
Neoplasm	DISZKGEW	Limited	Biomarker	[36]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[37]
Spinocerebellar ataxia type 17	DISJXO7P	Limited	Altered Expression	[38]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Teashirt homolog 1 (TSHZ1).	[39]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Teashirt homolog 1 (TSHZ1).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Teashirt homolog 1 (TSHZ1).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Teashirt homolog 1 (TSHZ1).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Teashirt homolog 1 (TSHZ1).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Teashirt homolog 1 (TSHZ1).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Teashirt homolog 1 (TSHZ1).	[46]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Teashirt homolog 1 (TSHZ1).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Teashirt homolog 1 (TSHZ1).	[48]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Teashirt homolog 1 (TSHZ1).	[49]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Teashirt homolog 1 (TSHZ1).	[50]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Teashirt homolog 1 (TSHZ1).	[51]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Teashirt homolog 1 (TSHZ1).	[52]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Teashirt homolog 1 (TSHZ1).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Teashirt homolog 1 (TSHZ1).	[54]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Teashirt homolog 1 (TSHZ1).	[56]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Teashirt homolog 1 (TSHZ1).	[57]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Teashirt homolog 1 (TSHZ1).	[58]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Teashirt homolog 1 (TSHZ1).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Teashirt homolog 1 (TSHZ1).	[55]

References

• [1] Ras mutations in United Kingdom examples of oral malignancies are infrequent.Int J Cancer. 1991 May 30;48(3):409-12. doi: 10.1002/ijc.2910480318.
• [2] Mutational analysis of the N-ras, p53, p16INK4a, CDK4, and MC1R genes in human congenital melanocytic naevi.J Med Genet. 1999 Aug;36(8):610-4.
• [3] Review: Vascular dementia: clinicopathologic and genetic considerations.Neuropathol Appl Neurobiol. 2018 Apr;44(3):247-266. doi: 10.1111/nan.12472. Epub 2018 Mar 1.
• [4] Cerebral amyloid angiopathy burden associated with leukoaraiosis: a positron emission tomography/magnetic resonance imaging study.Ann Neurol. 2013 Apr;73(4):529-36. doi: 10.1002/ana.23830. Epub 2013 Feb 19.
• [5] ATXN2 with intermediate-length CAG/CAA repeats does not seem to be a risk factor in hereditary spastic paraplegia.J Neurol Sci. 2012 Oct 15;321(1-2):100-2. doi: 10.1016/j.jns.2012.07.036. Epub 2012 Aug 3.
• [6] Sex-specific influence of DRD2 on ADHD-type temperament in a large population-based birth cohort.Psychiatr Genet. 2012 Aug;22(4):197-201. doi: 10.1097/YPG.0b013e32834c0cc8.
• [7] The AIB1 glutamine repeat polymorphism is not associated with risk of breast cancer before age 40 years in Australian women.Breast Cancer Res. 2005;7(3):R353-6. doi: 10.1186/bcr1009. Epub 2005 Mar 4.
• [8] SCA2 family presenting as typical Parkinson's disease: 34 year follow up.Parkinsonism Relat Disord. 2017 Jul;40:69-72. doi: 10.1016/j.parkreldis.2017.04.003. Epub 2017 Apr 12.
• [9] Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.Sci Rep. 2015 Dec 1;5:17369. doi: 10.1038/srep17369.
• [10] Narrowing the critical region for congenital vertical talus in patients with interstitial 18q deletions.Am J Med Genet A. 2013 May;161A(5):1117-21. doi: 10.1002/ajmg.a.35791. Epub 2013 Mar 13.
• [11] Cerebral amyloid angiopathy-related cognitive impairment: The search for a specific neuropsychological pattern.Rev Neurol (Paris). 2017 Nov;173(9):562-565. doi: 10.1016/j.neurol.2017.09.006. Epub 2017 Oct 6.
• [12] The association between dilated cardiomyopathy and RTN4 3'UTR insertion/deletion polymorphisms.Clin Chim Acta. 2009 Feb;400(1-2):21-4. doi: 10.1016/j.cca.2008.09.028. Epub 2008 Oct 8.
• [13] Association of polymorphisms -1154G/A and -2578C/A in the vascular endothelial growth factor gene with decreased risk of endometriosis in Chinese women.Hum Reprod. 2009 Oct;24(10):2660-6. doi: 10.1093/humrep/dep208. Epub 2009 Jun 16.
• [14] Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
• [15] Prion protein amyloidosis with divergent phenotype associated with two novel nonsense mutations in PRNP.Acta Neuropathol. 2010 Feb;119(2):189-97. doi: 10.1007/s00401-009-0609-x. Epub 2009 Nov 13.
• [16] Genetic alterations in primary glioblastomas in Japan.J Neuropathol Exp Neurol. 2006 Jan;65(1):12-8. doi: 10.1097/01.jnen.0000196132.66464.96.
• [17] Foxp3 gene polymorphisms and haplotypes associate with susceptibility of Graves' disease in Chinese Han population.Int Immunopharmacol. 2015 Apr;25(2):425-31. doi: 10.1016/j.intimp.2015.02.020. Epub 2015 Feb 21.
• [18] Association of CAA and TATC Insertion/Deletion Genetic Polymorphisms in RTN4 3'-UTR with Hepatocellular Carcinoma Risk.Pathol Oncol Res. 2018 Jan;24(1):31-34. doi: 10.1007/s12253-017-0204-8. Epub 2017 Jan 31.
• [19] CAG Repeat Not Polyglutamine Length Determines Timing of Huntington's Disease Onset.Cell. 2019 Aug 8;178(4):887-900.e14. doi: 10.1016/j.cell.2019.06.036.
• [20] CNR2 functional variant (Q63R) influences childhood immune thrombocytopenic purpura.Haematologica. 2011 Dec;96(12):1883-5. doi: 10.3324/haematol.2011.045732. Epub 2011 Aug 9.
• [21] TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction.J Clin Invest. 2014 Mar;124(3):1214-27. doi: 10.1172/JCI72466.
• [22] Mxi1 mutations in human neurofibrosarcomas.Jpn J Cancer Res. 1999 Jul;90(7):740-6. doi: 10.1111/j.1349-7006.1999.tb00809.x.
• [23] Frequency of UV-inducible NRAS mutations in melanomas of patients with germline CDKN2A mutations.J Natl Cancer Inst. 2003 Jun 4;95(11):790-8. doi: 10.1093/jnci/95.11.790.
• [24] Association study of 90 candidate gene polymorphisms in panic disorder.Psychiatr Genet. 2005 Mar;15(1):17-24. doi: 10.1097/00041444-200503000-00004.
• [25] The Pathogenic Role of Low Range Repeats in SCA17.PLoS One. 2015 Aug 12;10(8):e0135275. doi: 10.1371/journal.pone.0135275. eCollection 2015.
• [26] Common origin of pure and interrupted repeat expansions in spinocerebellar ataxia type 2 (SCA2).Am J Med Genet B Neuropsychiatr Genet. 2010 Mar 5;153B(2):524-531. doi: 10.1002/ajmg.b.31013.
• [27] N-ras mutation of thyroid tumor with special reference to the follicular type.Pathol Int. 1995 Jan;45(1):45-50. doi: 10.1111/j.1440-1827.1995.tb03378.x.
• [28] Gene expression profiling and identification of hub genes in Nellore cattle with different marbling score levels.Genomics. 2020 Jan;112(1):873-879. doi: 10.1016/j.ygeno.2019.06.001. Epub 2019 Jun 3.
• [29] Analysis of RTN4 3'UTR insertion/deletion polymorphisms in ventricular septal defect in a Chinese Han population.DNA Cell Biol. 2011 May;30(5):323-7. doi: 10.1089/dna.2010.1116. Epub 2010 Dec 17.
• [30] Two-step transplantation with adipose tissue-derived stem cells increases follicle survival by enhancing vascularization in xenografted frozen-thawed human ovarian tissue.Hum Reprod. 2018 Jun 1;33(6):1107-1116. doi: 10.1093/humrep/dey080.
• [31] CFH polymorphisms in a Northern Spanish population with neovascular and dry forms of age-related macular degeneration.Acta Ophthalmol. 2015 Dec;93(8):e658-66. doi: 10.1111/aos.12790. Epub 2015 Jul 8.
• [32] Association of genetic variations in RTN4 3'-UTR with risk for clear cell renal cell carcinoma.Fam Cancer. 2018 Jan;17(1):129-134. doi: 10.1007/s10689-017-0005-y.
• [33] Prevalence and characterization of methicillin-resistant Staphylococcus aureus among healthy children in a city of Argentina.Infect Genet Evol. 2011 Jul;11(5):1066-71. doi: 10.1016/j.meegid.2011.03.019. Epub 2011 Apr 2.
• [34] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [35] SLC44A2 single nucleotide polymorphisms, isoforms, and expression: Association with severity of Meniere's disease?.Genomics. 2016 Dec;108(5-6):201-208. doi: 10.1016/j.ygeno.2016.11.002. Epub 2016 Nov 6.
• [36] Genome-wide copy number profiling using a 100K SNP array reveals novel disease-related genes BORIS and TSHZ1 in juvenile angiofibroma.Int J Oncol. 2011 Nov;39(5):1143-51. doi: 10.3892/ijo.2011.1166. Epub 2011 Aug 18.
• [37] Tshz1 Regulates Pancreatic -Cell Maturation.Diabetes. 2015 Aug;64(8):2905-14. doi: 10.2337/db14-1443. Epub 2015 Apr 27.
• [38] SCA17 repeat expansion: mildly expanded CAG/CAA repeat alleles in neurological disorders and the functional implications.Clin Chim Acta. 2010 Mar;411(5-6):375-80. doi: 10.1016/j.cca.2009.12.002. Epub 2009 Dec 11.
• [39] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [45] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [52] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [53] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [54] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [55] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [56] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [57] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [58] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.