General Information of Drug Off-Target (DOT) (ID: OTZERX04)

DOT Name Guanylate cyclase activator 2B (GUCA2B)
Gene Name GUCA2B
Related Disease
Benign prostatic hyperplasia ( )
Adenocarcinoma ( )
Advanced cancer ( )
Cardiac failure ( )
Chronic kidney disease ( )
Colitis ( )
Colon cancer ( )
Colon carcinoma ( )
Colon polyp ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
End-stage renal disease ( )
Essential hypertension ( )
High blood pressure ( )
Inflammatory bowel disease ( )
Intestinal obstruction ( )
Nasal polyp ( )
Neoplasm ( )
Nephropathy ( )
Ulcerative colitis ( )
Chronic renal failure ( )
Intestinal disorder ( )
Nephrotic syndrome ( )
Obesity ( )
Secretory diarrhea ( )
UniProt ID
GUC2B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1UYA; 1UYB
Pfam ID
PF02058
Sequence
MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQ
SLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Function
Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Tissue Specificity Stomach and intestine.
Reactome Pathway
Digestion (R-HSA-8935690 )

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Benign prostatic hyperplasia DISI3CW2 Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Biomarker [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Cardiac failure DISDC067 Strong Biomarker [4]
Chronic kidney disease DISW82R7 Strong Biomarker [5]
Colitis DISAF7DD Strong Biomarker [6]
Colon cancer DISVC52G Strong Genetic Variation [7]
Colon carcinoma DISJYKUO Strong Genetic Variation [7]
Colon polyp DIS7V594 Strong Biomarker [2]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [8]
Congestive heart failure DIS32MEA Strong Biomarker [4]
End-stage renal disease DISXA7GG Strong Biomarker [5]
Essential hypertension DIS7WI98 Strong Biomarker [9]
High blood pressure DISY2OHH Strong Genetic Variation [9]
Inflammatory bowel disease DISGN23E Strong Altered Expression [6]
Intestinal obstruction DISE52WH Strong Biomarker [10]
Nasal polyp DISLP3XE Strong Altered Expression [11]
Neoplasm DISZKGEW Strong Biomarker [8]
Nephropathy DISXWP4P Strong Biomarker [12]
Ulcerative colitis DIS8K27O Strong Altered Expression [13]
Chronic renal failure DISGG7K6 Limited Biomarker [5]
Intestinal disorder DISGPMUQ Limited Altered Expression [14]
Nephrotic syndrome DISSPSC2 Limited Biomarker [5]
Obesity DIS47Y1K Limited Altered Expression [15]
Secretory diarrhea DISBX8WG Limited Biomarker [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Guanylate cyclase activator 2B (GUCA2B). [16]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Guanylate cyclase activator 2B (GUCA2B). [17]
------------------------------------------------------------------------------------

References

1 Occurrence and localization of uroguanylin in the aging human prostate.Histochem Cell Biol. 2003 Jan;119(1):69-76. doi: 10.1007/s00418-002-0490-3. Epub 2002 Dec 21.
2 Uroguanylin treatment suppresses polyp formation in the Apc(Min/+) mouse and induces apoptosis in human colon adenocarcinoma cells via cyclic GMP.Cancer Res. 2000 Sep 15;60(18):5151-7.
3 Colonic epithelial cell diversity in health and inflammatory bowel disease.Nature. 2019 Mar;567(7746):49-55. doi: 10.1038/s41586-019-0992-y. Epub 2019 Feb 27.
4 Uroguanylin: a new actor in the energy balance movie.J Mol Endocrinol. 2018 Feb;60(2):R31-R38. doi: 10.1530/JME-17-0263. Epub 2017 Dec 4.
5 Guanylin and uroguanylin regulate electrolyte transport in isolated human cortical collecting ducts.Kidney Int. 2005 Apr;67(4):1420-7. doi: 10.1111/j.1523-1755.2005.00219.x.
6 The guanylate cyclase-C signaling pathway is down-regulated in inflammatory bowel disease.Scand J Gastroenterol. 2015;50(10):1241-52. doi: 10.3109/00365521.2015.1038849. Epub 2015 May 15.
7 Hybrid Method Based on Information Gain and Support Vector Machine for Gene Selection in Cancer Classification.Genomics Proteomics Bioinformatics. 2017 Dec;15(6):389-395. doi: 10.1016/j.gpb.2017.08.002. Epub 2017 Dec 12.
8 Intestinal GUCY2C prevents TGF- secretion coordinating desmoplasia and hyperproliferation in colorectal cancer.Cancer Res. 2013 Nov 15;73(22):6654-66. doi: 10.1158/0008-5472.CAN-13-0887. Epub 2013 Oct 1.
9 Haplotype-based case-control study of the association between the guanylate cyclase activator 2B (GUCA2B, Uroguanylin) gene and essential hypertension.Hypertens Res. 2007 Sep;30(9):789-96. doi: 10.1291/hypres.30.789.
10 Synthesis of phenylpyrimidinones as guanylyl cyclase C inhibitors.Pharmazie. 2019 Jan 1;74(1):15-17. doi: 10.1691/ph.2019.8775.
11 Expression of guanylin and uroguanylin mRNA in human nasal mucosa and nasal polyps.Acta Otolaryngol. 2004 Mar;124(2):179-85. doi: 10.1080/00016480310016073.
12 Guanylate Cyclase C: A Current Hot Target, from Physiology to Pathology.Curr Med Chem. 2018;25(16):1879-1908. doi: 10.2174/0929867325666171205150310.
13 Expression of guanylate cyclase-C, guanylin, and uroguanylin is downregulated proportionally to the ulcerative colitis disease activity index.Sci Rep. 2016 Apr 29;6:25034. doi: 10.1038/srep25034.
14 Guanylin regulatory peptides: structures, biological activities mediated by cyclic GMP and pathobiology.Regul Pept. 1999 May 31;81(1-3):25-39. doi: 10.1016/s0167-0115(99)00033-6.
15 Immunohistochemical Staining for Uroguanylin, a Satiety Hormone, is Decreased in Intestinal Tissue Specimens From Female Adolescents With Obesity.Pediatr Dev Pathol. 2018 May-Jun;21(3):285-295. doi: 10.1177/1093526617722912. Epub 2017 Aug 29.
16 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.