Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZQIUHQ)

• DOT Name: UPF0500 protein C1orf216 (C1ORF216)
• Gene Name: C1ORF216
• UniProt ID: CA216_HUMAN
• Pfam ID: PF15546
• Sequence:
  MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRS
  SSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGGAGTVCSPLEDNGYASSSLSI
  DSRSSSPEPACGTPRGPGPPDPLLPSVAQAVQHLQVQERYKEQEKEKHHVHLVMYRRLAL
  LQWIRGLQHQLIDQQARLQESFDTILDNRKELIRCLQQRAAPSRPQDQA

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of UPF0500 protein C1orf216 (C1ORF216).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of UPF0500 protein C1orf216 (C1ORF216).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of UPF0500 protein C1orf216 (C1ORF216).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[7]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of UPF0500 protein C1orf216 (C1ORF216).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of UPF0500 protein C1orf216 (C1ORF216).	[10]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [10] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.