General Information of Drug (ID: DM0GOUD)

Drug Name
Urokinase
Indication
Disease Entry ICD 11 Status REF
Myocardial infarction BA41-BA43 Approved [1]
Pulmonary embolism BB00 Approved [2]
Therapeutic Class
Thrombolytic Agents
Affected Organisms
Humans and other mammals
ATC Code
B01AD04: Urokinase
B01AD: Enzymes
B01A: ANTITHROMBOTIC AGENTS
B01: ANTITHROMBOTIC AGENTS
B: BLOOD AND BLOOD FORMING ORGANS
Sequence
KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMS
PCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHND
IALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMT
VVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVS
WGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 12.6 +/- 6.2 minutes [3]
Metabolism
The drug is metabolized via proteases to smaller proteins and amino acids []
Vd
The volume of distribution (Vd) of drug is 11.5 L [3]
Adverse Drug Reaction (ADR)
ADR Term Variation Related DOT DOT ID REF
Chromosomal abnormalities and abnormal gene carriers Not Available ITGAV OTAM7JTR [4]
Chromosomal abnormalities and abnormal gene carriers Not Available PLAUR OTIRKKEQ [4]
Chromosomal abnormalities and abnormal gene carriers Not Available CSK OTP03OD0 [4]
Diabetes mellitus Not Available MAPK1 OTH85PI5 [4]
Cross-matching ID
PubChem CID
33309
UNII
83G67E21XI
DrugBank ID
DB00013
TTD ID
D0E8UO
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Urokinase-type plasminogen activator (PLAU) TTGY7WI UROK_HUMAN Modulator [5]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Integrin alpha-V (ITGAV) OTAM7JTR ITAV_HUMAN Drug Response [4]
Mitogen-activated protein kinase 1 (MAPK1) OTH85PI5 MK01_HUMAN Drug Response [4]
Tyrosine-protein kinase CSK (CSK) OTP03OD0 CSK_HUMAN Drug Response [4]
Urokinase plasminogen activator surface receptor (PLAUR) OTIRKKEQ UPAR_HUMAN Drug Response [4]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Myocardial infarction
ICD Disease Classification BA41-BA43
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Urokinase-type plasminogen activator (PLAU) DTT PLAU 5.32E-70 1.07 1.82
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Urokinase
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Urokinase and Prasugrel. Myocardial infarction [BA41-BA43] [6]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Urokinase and Vorapaxar. Myocardial infarction [BA41-BA43] [7]
Coadministration of a Drug Treating the Disease Different from Urokinase (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Cilostazol DMZMSCT Moderate Increased risk of bleeding by the combination of Urokinase and Cilostazol. Arterial occlusive disease [BD40] [8]
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Urokinase and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [9]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Urokinase and Pentosan polysulfate. Chronic pain [MG30] [10]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Urokinase and Ketoprofen. Chronic pain [MG30] [11]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Urokinase and Levomilnacipran. Chronic pain [MG30] [12]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Urokinase and Regorafenib. Colorectal cancer [2B91] [6]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Urokinase and Intedanib. Colorectal cancer [2B91] [13]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Urokinase and Ardeparin. Coronary thrombosis [BA43] [14]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Urokinase and Rivaroxaban. Deep vein thrombosis [BD71] [15]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Urokinase and Sertraline. Depression [6A70-6A7Z] [12]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Urokinase and Fluoxetine. Depression [6A70-6A7Z] [12]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Urokinase and Vilazodone. Depression [6A70-6A7Z] [12]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Urokinase and Paroxetine. Depression [6A70-6A7Z] [12]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Urokinase and Vortioxetine. Depression [6A70-6A7Z] [12]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Urokinase and Duloxetine. Depression [6A70-6A7Z] [12]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Urokinase and Milnacipran. Depression [6A70-6A7Z] [12]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Urokinase and Escitalopram. Depression [6A70-6A7Z] [12]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Urokinase and Desvenlafaxine. Depression [6A70-6A7Z] [12]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Urokinase and Clomipramine. Depression [6A70-6A7Z] [12]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Urokinase and Fluvoxamine. Depression [6A70-6A7Z] [12]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Urokinase and Venlafaxine. Depression [6A70-6A7Z] [12]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Urokinase and Apigenin. Discovery agent [N.A.] [16]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Urokinase and Citalopram derivative 1. Discovery agent [N.A.] [12]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Urokinase and PMID28870136-Compound-49. Discovery agent [N.A.] [17]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Urokinase and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [12]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Urokinase and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [11]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Urokinase and Mefenamic acid. Female pelvic pain [GA34] [11]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Urokinase and Avapritinib. Gastrointestinal stromal tumour [2B5B] [6]
Ramipril DM2R68E Moderate Increased risk of angioedema by the combination of Urokinase and Ramipril. Heart failure [BD10-BD1Z] [18]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Urokinase and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [19]
Moexipril DM26E4B Moderate Increased risk of angioedema by the combination of Urokinase and Moexipril. Hypertension [BA00-BA04] [18]
Captopril DM458UM Moderate Increased risk of angioedema by the combination of Urokinase and Captopril. Hypertension [BA00-BA04] [18]
Trandolapril DM4L6EU Moderate Increased risk of angioedema by the combination of Urokinase and Trandolapril. Hypertension [BA00-BA04] [18]
Fosinopril DM9NJ52 Moderate Increased risk of angioedema by the combination of Urokinase and Fosinopril. Hypertension [BA00-BA04] [18]
Enalapril DMNFUZR Moderate Increased risk of angioedema by the combination of Urokinase and Enalapril. Hypertension [BA00-BA04] [18]
Perindopril DMOPZDT Moderate Increased risk of angioedema by the combination of Urokinase and Perindopril. Hypertension [BA00-BA04] [18]
Quinapril DMR8H31 Moderate Increased risk of angioedema by the combination of Urokinase and Quinapril. Hypertension [BA00-BA04] [18]
Lisinopril DMUOK4C Moderate Increased risk of angioedema by the combination of Urokinase and Lisinopril. Hypertension [BA00-BA04] [18]
Dipyridamole DMXY30O Moderate Increased risk of bleeding by the combination of Urokinase and Dipyridamole. Hypertension [BA00-BA04] [8]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Urokinase and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [11]
Ticlopidine DMO946V Moderate Increased risk of bleeding by the combination of Urokinase and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [8]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Urokinase and Acalabrutinib. Mature B-cell lymphoma [2A85] [20]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Urokinase and Ibrutinib. Mature B-cell lymphoma [2A85] [21]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Urokinase and Ponatinib. Mature B-cell lymphoma [2A85] [22]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Urokinase and Panobinostat. Multiple myeloma [2A83] [18]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Urokinase and Dasatinib. Myeloproliferative neoplasm [2A20] [23]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Urokinase and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [10]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Urokinase and Sibutramine. Obesity [5B80-5B81] [12]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Urokinase and Diclofenac. Osteoarthritis [FA00-FA05] [11]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Urokinase and Nepafenac. Osteoarthritis [FA00-FA05] [11]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Urokinase and Naproxen. Osteoarthritis [FA00-FA05] [11]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Urokinase and MK-4827. Ovarian cancer [2C73] [6]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Urokinase and Aspirin. Pain [MG30-MG3Z] [8]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Urokinase and Etodolac. Pain [MG30-MG3Z] [11]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Urokinase and Diflunisal. Pain [MG30-MG3Z] [8]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Urokinase and Ibuprofen. Pain [MG30-MG3Z] [11]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Urokinase and Nabumetone. Pain [MG30-MG3Z] [11]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Urokinase and Piroxicam. Pain [MG30-MG3Z] [11]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Urokinase and Choline salicylate. Postoperative inflammation [1A00-CA43] [8]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Urokinase and Ketorolac. Postoperative inflammation [1A00-CA43] [11]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Urokinase and Bromfenac. Postoperative inflammation [1A00-CA43] [11]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Urokinase and Treprostinil. Pulmonary hypertension [BB01] [8]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Urokinase and Epoprostenol. Pulmonary hypertension [BB01] [8]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Urokinase and Iloprost. Pulmonary hypertension [BB01] [8]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Urokinase and Salsalate. Rheumatoid arthritis [FA20] [8]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Urokinase and Meloxicam. Rheumatoid arthritis [FA20] [11]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Urokinase and Sulindac. Rheumatoid arthritis [FA20] [11]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Urokinase and Oxaprozin. Rheumatoid arthritis [FA20] [11]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Urokinase and Flurbiprofen. Rheumatoid arthritis [FA20] [11]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Urokinase and Fenoprofen. Rheumatoid arthritis [FA20] [11]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Urokinase and Indomethacin. Rheumatoid arthritis [FA20] [11]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Urokinase and Tolmetin. Rheumatoid arthritis [FA20] [11]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Urokinase and Curcumin. Solid tumour/cancer [2A00-2F9Z] [24]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Urokinase and Warfarin. Supraventricular tachyarrhythmia [BC81] [25]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Urokinase and Caplacizumab. Thrombocytopenia [3B64] [18]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Urokinase and Apixaban. Thrombosis [DB61-GB90] [6]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Urokinase and Cangrelor. Thrombosis [DB61-GB90] [6]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Urokinase and Brilinta. Thrombosis [DB61-GB90] [6]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Urokinase and Argatroban. Thrombosis [DB61-GB90] [26]
Clopidogrel DMOL54H Moderate Increased risk of bleeding by the combination of Urokinase and Clopidogrel. Thrombosis [DB61-GB90] [8]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Urokinase and Cabozantinib. Thyroid cancer [2D10] [27]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Urokinase and Betrixaban. Venous thromboembolism [BD72] [28]
⏷ Show the Full List of 82 DDI Information of This Drug

References

1 Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
2 Comparative Efficacy and Safety of Thrombolytic Agents for Pulmonary Embolism: A Bayesian Network Meta-Analysis. Pharmacology. 2023;108(2):111-126.
3 FDA Approved Drug Products: Kinlytic Urokinase Injection (Discontinued)
4 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
5 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
6 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
7 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
8 Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
9 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
10 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
11 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
12 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
13 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
14 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
15 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
16 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
17 Canadian Pharmacists Association.
18 Cerner Multum, Inc. "Australian Product Information.".
19 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
20 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
21 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
22 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
23 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
24 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
25 Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
26 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
27 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
28 Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.