Details of the Drug

General Information of Drug (ID: DM6Q4B0)

Drug Name
Anistreplase
Indication
Disease Entry ICD 11 Status REF
Acute coronary syndrome BA41 Approved [1]
Therapeutic Class
Thrombolytic Agents
Affected Organisms
Humans and other mammals
ATC Code
B01AD03: Anistreplase
B01AD: Enzymes
B01A: ANTITHROMBOTIC AGENTS
B01: ANTITHROMBOTIC AGENTS
B: BLOOD AND BLOOD FORMING ORGANS
Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Cross-matching ID
UNII
5O8V541HJ6
DrugBank ID
DB00029
TTD ID
D0K4DI

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Plasminogen (PLG) TTP86E2 PLMN_HUMAN Activator [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Acute coronary syndrome
ICD Disease Classification BA41
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Plasminogen (PLG) DTT PLG 8.61E-01 -0.01 -0.09
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Anistreplase
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Prasugrel DM7MT6E Major Increased risk of bleeding by the combination of Anistreplase and Prasugrel. Myocardial infarction [BA41-BA43] [3]
Vorapaxar DMA16BR Major Increased risk of bleeding by the combination of Anistreplase and Vorapaxar. Myocardial infarction [BA41-BA43] [4]
Coadministration of a Drug Treating the Disease Different from Anistreplase (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Cilostazol DMZMSCT Moderate Increased risk of bleeding by the combination of Anistreplase and Cilostazol. Arterial occlusive disease [BD40] [5]
Drotrecogin alfa DM59JCN Major Increased risk of bleeding by the combination of Anistreplase and Drotrecogin alfa. Cerebral ischaemia [8B1Z] [6]
Pentosan polysulfate DM2HRKE Moderate Increased risk of bleeding by the combination of Anistreplase and Pentosan polysulfate. Chronic pain [MG30] [7]
Ketoprofen DMRKXPT Moderate Increased risk of bleeding by the combination of Anistreplase and Ketoprofen. Chronic pain [MG30] [8]
Levomilnacipran DMV26S8 Moderate Increased risk of bleeding by the combination of Anistreplase and Levomilnacipran. Chronic pain [MG30] [9]
Regorafenib DMHSY1I Major Increased risk of bleeding by the combination of Anistreplase and Regorafenib. Colorectal cancer [2B91] [3]
Intedanib DMSTA36 Moderate Increased risk of bleeding by the combination of Anistreplase and Intedanib. Colorectal cancer [2B91] [10]
Ardeparin DMYRX8B Major Increased risk of bleeding by the combination of Anistreplase and Ardeparin. Coronary thrombosis [BA43] [11]
Rivaroxaban DMQMBZ1 Major Increased risk of bleeding by the combination of Anistreplase and Rivaroxaban. Deep vein thrombosis [BD71] [12]
Sertraline DM0FB1J Moderate Increased risk of bleeding by the combination of Anistreplase and Sertraline. Depression [6A70-6A7Z] [9]
Fluoxetine DM3PD2C Moderate Increased risk of bleeding by the combination of Anistreplase and Fluoxetine. Depression [6A70-6A7Z] [9]
Vilazodone DM4LECQ Moderate Increased risk of bleeding by the combination of Anistreplase and Vilazodone. Depression [6A70-6A7Z] [9]
Paroxetine DM5PVQE Moderate Increased risk of bleeding by the combination of Anistreplase and Paroxetine. Depression [6A70-6A7Z] [9]
Vortioxetine DM6F1PU Moderate Increased risk of bleeding by the combination of Anistreplase and Vortioxetine. Depression [6A70-6A7Z] [9]
Duloxetine DM9BI7M Moderate Increased risk of bleeding by the combination of Anistreplase and Duloxetine. Depression [6A70-6A7Z] [9]
Milnacipran DMBFE74 Moderate Increased risk of bleeding by the combination of Anistreplase and Milnacipran. Depression [6A70-6A7Z] [9]
Escitalopram DMFK9HG Moderate Increased risk of bleeding by the combination of Anistreplase and Escitalopram. Depression [6A70-6A7Z] [9]
Desvenlafaxine DMHD4PE Moderate Increased risk of bleeding by the combination of Anistreplase and Desvenlafaxine. Depression [6A70-6A7Z] [9]
Clomipramine DMINRKW Moderate Increased risk of bleeding by the combination of Anistreplase and Clomipramine. Depression [6A70-6A7Z] [9]
Fluvoxamine DMQTJSX Moderate Increased risk of bleeding by the combination of Anistreplase and Fluvoxamine. Depression [6A70-6A7Z] [9]
Venlafaxine DMR6QH0 Moderate Increased risk of bleeding by the combination of Anistreplase and Venlafaxine. Depression [6A70-6A7Z] [9]
Apigenin DMI3491 Minor Increased risk of bleeding by the combination of Anistreplase and Apigenin. Discovery agent [N.A.] [13]
Citalopram derivative 1 DMITX1G Moderate Increased risk of bleeding by the combination of Anistreplase and Citalopram derivative 1. Discovery agent [N.A.] [9]
PMID28870136-Compound-49 DMTUC9E Moderate Increased risk of bleeding by the combination of Anistreplase and PMID28870136-Compound-49. Discovery agent [N.A.] [14]
Fenfluramine DM0762O Moderate Increased risk of bleeding by the combination of Anistreplase and Fenfluramine. Epilepsy/seizure [8A61-8A6Z] [9]
Suprofen DMKXJZ7 Moderate Increased risk of bleeding by the combination of Anistreplase and Suprofen. Eye anterior segment structural developmental anomaly [LA11] [8]
Mefenamic acid DMK7HFI Moderate Increased risk of bleeding by the combination of Anistreplase and Mefenamic acid. Female pelvic pain [GA34] [8]
Avapritinib DMK2GZX Major Increased risk of bleeding by the combination of Anistreplase and Avapritinib. Gastrointestinal stromal tumour [2B5B] [3]
Ramipril DM2R68E Moderate Increased risk of angioedema by the combination of Anistreplase and Ramipril. Heart failure [BD10-BD1Z] [15]
Tipranavir DM8HJX6 Major Increased risk of bleeding by the combination of Anistreplase and Tipranavir. Human immunodeficiency virus disease [1C60-1C62] [16]
Captopril DM458UM Moderate Increased risk of angioedema by the combination of Anistreplase and Captopril. Hypertension [BA00-BA04] [15]
Trandolapril DM4L6EU Moderate Increased risk of angioedema by the combination of Anistreplase and Trandolapril. Hypertension [BA00-BA04] [15]
Fosinopril DM9NJ52 Moderate Increased risk of angioedema by the combination of Anistreplase and Fosinopril. Hypertension [BA00-BA04] [15]
Enalapril DMNFUZR Moderate Increased risk of angioedema by the combination of Anistreplase and Enalapril. Hypertension [BA00-BA04] [15]
Perindopril DMOPZDT Moderate Increased risk of angioedema by the combination of Anistreplase and Perindopril. Hypertension [BA00-BA04] [15]
Quinapril DMR8H31 Moderate Increased risk of angioedema by the combination of Anistreplase and Quinapril. Hypertension [BA00-BA04] [15]
Lisinopril DMUOK4C Moderate Increased risk of angioedema by the combination of Anistreplase and Lisinopril. Hypertension [BA00-BA04] [15]
Dipyridamole DMXY30O Moderate Increased risk of bleeding by the combination of Anistreplase and Dipyridamole. Hypertension [BA00-BA04] [5]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Anistreplase and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [8]
Ticlopidine DMO946V Moderate Increased risk of bleeding by the combination of Anistreplase and Ticlopidine. Ischaemic/haemorrhagic stroke [8B20] [5]
Acalabrutinib DM7GCVW Major Increased risk of bleeding by the combination of Anistreplase and Acalabrutinib. Mature B-cell lymphoma [2A85] [17]
Ibrutinib DMHZCPO Major Increased risk of bleeding by the combination of Anistreplase and Ibrutinib. Mature B-cell lymphoma [2A85] [18]
Ponatinib DMYGJQO Major Increased risk of bleeding by the combination of Anistreplase and Ponatinib. Mature B-cell lymphoma [2A85] [19]
Panobinostat DM58WKG Major Increased risk of bleeding by the combination of Anistreplase and Panobinostat. Multiple myeloma [2A83] [15]
Dasatinib DMJV2EK Major Increased risk of bleeding by the combination of Anistreplase and Dasatinib. Myeloproliferative neoplasm [2A20] [20]
Omacetaxine mepesuccinate DMPU2WX Major Increased risk of bleeding by the combination of Anistreplase and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [7]
Sibutramine DMFJTDI Moderate Increased risk of bleeding by the combination of Anistreplase and Sibutramine. Obesity [5B80-5B81] [21]
Diclofenac DMPIHLS Moderate Increased risk of bleeding by the combination of Anistreplase and Diclofenac. Osteoarthritis [FA00-FA05] [8]
Nepafenac DMYK490 Moderate Increased risk of bleeding by the combination of Anistreplase and Nepafenac. Osteoarthritis [FA00-FA05] [8]
Naproxen DMZ5RGV Moderate Increased risk of bleeding by the combination of Anistreplase and Naproxen. Osteoarthritis [FA00-FA05] [8]
MK-4827 DMLYGH4 Moderate Increased risk of bleeding by the combination of Anistreplase and MK-4827. Ovarian cancer [2C73] [3]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Anistreplase and Aspirin. Pain [MG30-MG3Z] [5]
Etodolac DM6WJO9 Moderate Increased risk of bleeding by the combination of Anistreplase and Etodolac. Pain [MG30-MG3Z] [8]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Anistreplase and Diflunisal. Pain [MG30-MG3Z] [5]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Anistreplase and Ibuprofen. Pain [MG30-MG3Z] [8]
Nabumetone DMAT2XH Moderate Increased risk of bleeding by the combination of Anistreplase and Nabumetone. Pain [MG30-MG3Z] [8]
Piroxicam DMTK234 Moderate Increased risk of bleeding by the combination of Anistreplase and Piroxicam. Pain [MG30-MG3Z] [8]
Choline salicylate DM8P137 Moderate Increased risk of bleeding by the combination of Anistreplase and Choline salicylate. Postoperative inflammation [1A00-CA43] [5]
Ketorolac DMI4EL5 Moderate Increased risk of bleeding by the combination of Anistreplase and Ketorolac. Postoperative inflammation [1A00-CA43] [8]
Bromfenac DMKB79O Moderate Increased risk of bleeding by the combination of Anistreplase and Bromfenac. Postoperative inflammation [1A00-CA43] [8]
Treprostinil DMTIQF3 Moderate Increased risk of bleeding by the combination of Anistreplase and Treprostinil. Pulmonary hypertension [BB01] [5]
Epoprostenol DMUTYR2 Moderate Increased risk of bleeding by the combination of Anistreplase and Epoprostenol. Pulmonary hypertension [BB01] [5]
Iloprost DMVPZBE Moderate Increased risk of bleeding by the combination of Anistreplase and Iloprost. Pulmonary hypertension [BB01] [5]
Salsalate DM13P4C Moderate Increased risk of bleeding by the combination of Anistreplase and Salsalate. Rheumatoid arthritis [FA20] [5]
Meloxicam DM2AR7L Moderate Increased risk of bleeding by the combination of Anistreplase and Meloxicam. Rheumatoid arthritis [FA20] [8]
Sulindac DM2QHZU Moderate Increased risk of bleeding by the combination of Anistreplase and Sulindac. Rheumatoid arthritis [FA20] [8]
Oxaprozin DM9UB0P Moderate Increased risk of bleeding by the combination of Anistreplase and Oxaprozin. Rheumatoid arthritis [FA20] [8]
Flurbiprofen DMGN4BY Moderate Increased risk of bleeding by the combination of Anistreplase and Flurbiprofen. Rheumatoid arthritis [FA20] [8]
Fenoprofen DML5VQ0 Moderate Increased risk of bleeding by the combination of Anistreplase and Fenoprofen. Rheumatoid arthritis [FA20] [8]
Indomethacin DMSC4A7 Moderate Increased risk of bleeding by the combination of Anistreplase and Indomethacin. Rheumatoid arthritis [FA20] [8]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Anistreplase and Tolmetin. Rheumatoid arthritis [FA20] [8]
Curcumin DMQPH29 Minor Increased risk of bleeding by the combination of Anistreplase and Curcumin. Solid tumour/cancer [2A00-2F9Z] [22]
Warfarin DMJYCVW Major Increased risk of bleeding by the combination of Anistreplase and Warfarin. Supraventricular tachyarrhythmia [BC81] [23]
Caplacizumab DMPUKA7 Major Increased risk of bleeding by the combination of Anistreplase and Caplacizumab. Thrombocytopenia [3B64] [15]
Apixaban DM89JLN Major Increased risk of bleeding by the combination of Anistreplase and Apixaban. Thrombosis [DB61-GB90] [3]
Cangrelor DM8JRH0 Major Increased risk of bleeding by the combination of Anistreplase and Cangrelor. Thrombosis [DB61-GB90] [24]
Brilinta DMBR01X Moderate Increased risk of bleeding by the combination of Anistreplase and Brilinta. Thrombosis [DB61-GB90] [3]
Argatroban DMFI46A Major Increased risk of bleeding by the combination of Anistreplase and Argatroban. Thrombosis [DB61-GB90] [25]
Clopidogrel DMOL54H Moderate Increased risk of bleeding by the combination of Anistreplase and Clopidogrel. Thrombosis [DB61-GB90] [5]
Cabozantinib DMIYDT4 Major Increased risk of bleeding by the combination of Anistreplase and Cabozantinib. Thyroid cancer [2D10] [26]
Betrixaban DM2C4RF Major Increased risk of bleeding by the combination of Anistreplase and Betrixaban. Venous thromboembolism [BD72] [24]
⏷ Show the Full List of 81 DDI Information of This Drug

References

1 Acylated plasminogen-streptokinase activator complex: a new approach to thrombolytic therapy. Pharmacotherapy. 1990;10(2):115-26.
2 Evaluation of thrombolytic agents. Drugs. 1997;54 Suppl 3:11-6; discussion 16-7.
3 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
4 Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
5 Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
6 Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
7 Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
8 Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
9 Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
10 Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
11 Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
12 Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
13 Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
14 Canadian Pharmacists Association.
15 Cerner Multum, Inc. "Australian Product Information.".
16 Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
17 Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
18 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
19 Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
20 Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
21 Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
22 Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
23 Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
24 Bodiford AB, Kessler FO, Fermo JD, Ragucci KR "Elevated international normalized ratio with the consumption of grapefruit and use of warfarin." SAGE Open Med Case Rep 0 (2013): 1-3. [PMID: 27489634]
25 Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
26 Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.