Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T53381
|
||||
| Former ID |
TTDS00030
|
||||
| Target Name |
Alpha-1D adrenergic receptor
|
||||
| Gene Name |
ADRA1D
|
||||
| Synonyms |
Alpha 1D-adrenoceptor; Alpha 1D-adrenoreceptor; Alpha adrenergic receptor 1a; Alpha-1A adrenergic receptor; ADRA1D
|
||||
| Target Type |
Successful
|
||||
| Disease | Benign prostatic hyperplasia [ICD9: 600; ICD10: N40] | ||||
| Congestive heart failure [ICD9: 428; ICD10: I50] | |||||
| Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
| Erectile dysfunction [ICD9: 302.72, 607.84; ICD10: F52.2, N48.4] | |||||
| Fecal incontinence [ICD10: R15] | |||||
| Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
| Heart arrhythmia [ICD10: I47-I49] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Prostate hyperplasia [ICD10: N40] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Pediatric cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Prostate disease [ICD10: N42.9] | |||||
| Peripheral vascular disease [ICD9: 443.9; ICD10: I73.9] | |||||
| Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
This alpha-adrenergic receptor mediatesits effect through the influx of extracellular calcium.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T53381
|
||||
| UniProt ID | |||||
| Sequence |
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alfuzosin | Drug Info | Approved | Benign prostatic hyperplasia | [536610], [542116] |
| Armodafinil | Drug Info | Approved | Pediatric cancer | [551871] | |
| Bunazosin | Drug Info | Approved | Glaucoma | [551871] | |
| Doxazosin | Drug Info | Approved | Hypertension | [536610], [542180] | |
| Moxisylyte | Drug Info | Approved | Erectile dysfunction | [551871] | |
| Phenylephrine hydrochloride gel | Drug Info | Approved | Fecal incontinence | [547809] | |
| Terazosin | Drug Info | Approved | Benign prostatic hyperplasia | [538289], [542324] | |
| Trimazosin | Drug Info | Approved | Congestive heart failure | [551871] | |
| MEDETOMIDINE | Drug Info | Phase 2 | Pain | [529347] | |
| DL-017 | Drug Info | Phase 1 | Hypertension | [526190] | |
| INDORAMIN | Drug Info | Withdrawn from market | Hypertension | [468125], [551871] | |
| Sunepitron | Drug Info | Discontinued in Phase 3 | Discovery agent | [545699] | |
| TIOSPIRONE | Drug Info | Discontinued in Phase 3 | Discovery agent | [538617], [544679] | |
| Dabuzalgron | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [540407], [547205] | |
| Deriglidole | Drug Info | Discontinued in Phase 2 | Diabetes | [544511] | |
| FCE-22716 | Drug Info | Discontinued in Phase 2 | Hypertension | [533340] | |
| FIDUXOSIN HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Prostate disease | [547070] | |
| GYKI-16084 | Drug Info | Discontinued in Phase 2 | Prostate disease | [546866] | |
| JTH-601 | Drug Info | Discontinued in Phase 2 | Prostate disease | [546856] | |
| MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [545274] | |
| NS-49 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [468041], [545984] | |
| OPC-28326 | Drug Info | Discontinued in Phase 2 | Peripheral vascular disease | [546957] | |
| REC-15-2739 | Drug Info | Discontinued in Phase 2 | Prostate disease | [545508] | |
| SL-25.1039 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [547287] | |
| SL-89.0591 | Drug Info | Discontinued in Phase 2 | Prostate disease | [545536] | |
| SOU-001 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [547251] | |
| SUN-9221 | Drug Info | Discontinued in Phase 1 | Hypertension | [546178] | |
| ABANOQUIL | Drug Info | Terminated | Discovery agent | [544556] | |
| AGN-193080 | Drug Info | Terminated | Discovery agent | [546437] | |
| BMY-7378 | Drug Info | Terminated | Discovery agent | [543289], [544847] | |
| CR-2991 | Drug Info | Terminated | Hypertension | [547727] | |
| NIGULDIPINE | Drug Info | Terminated | Discovery agent | [468083], [545183] | |
| Siramesine | Drug Info | Terminated | Discovery agent | [545008] | |
| SK&F-104078 | Drug Info | Terminated | Discovery agent | [544626] | |
| SK&F-104856 | Drug Info | Terminated | Discovery agent | [544924] | |
| SL-91.0893 | Drug Info | Terminated | Prostate hyperplasia | [546240] | |
| SNAP-5089 | Drug Info | Terminated | Heart arrhythmia | [468115], [546179] | |
| WB-4101 | Drug Info | Terminated | Discovery agent | [468117], [545656] | |
| Sunepitron | Drug Info | Investigative | Unspecified | [528210] | |
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| (2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [534315] | |||
| (2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [534315] | |||
| 1',2',3',6'-Tetrahydro-[2,4']bipyridinyl | Drug Info | [533509] | |||
| 1-(2-Chloro-phenyl)-piperazine | Drug Info | [528039] | |||
| 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [528039] | |||
| 1-(3-Fluoro-pyridin-2-yl)-4-methyl-piperazine | Drug Info | [533509] | |||
| 1-(pyridin-2-yl)piperazine | Drug Info | [533509] | |||
| 2-Pyridin-4-yl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [526618] | |||
| 4-((E)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-((Z)-1-Naphthalen-1-yl-propenyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole | Drug Info | [533805] | |||
| 4-(1-Naphthalen-1-yl-propyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(1-Naphthalen-1-yl-vinyl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(2,3-Dihydro-1H-phenalen-1-yl)-1H-imidazole | Drug Info | [534160] | |||
| 4-(3,4-Dihydro-1H-isoquinolin-2-yl)-quinoline | Drug Info | [526618] | |||
| 4-(3-Hydroxy-piperidin-3-yl)-benzene-1,2-diol | Drug Info | [526729] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-(4-chlorobenzyl)-2-allylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-chlorobenzyl)-2-methylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-chlorobenzyl)phthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-(4-Isopropyl-morpholin-2-yl)-benzene-1,2-diol | Drug Info | [526729] | |||
| 4-(4-Methyl-indan-1-yl)-1H-imidazole | Drug Info | [534467] | |||
| 4-Benzo[b]thiophen-4-yl-1H-imidazole | Drug Info | [525720] | |||
| 4-benzyl-2-methylphthalazin-1(2H)-one | Drug Info | [528062] | |||
| 4-Morpholin-2-yl-benzene-1,2-diol | Drug Info | [526729] | |||
| 5-Bromo-8-piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [526778] | |||
| 6-hydroxy-3-(3',5'-dihydroxyphenyl)coumarin | Drug Info | [527848] | |||
| 8-Piperazin-1-yl-imidazo[1,2-a]pyrazine | Drug Info | [526778] | |||
| ABANOQUIL | Drug Info | [533682] | |||
| AGN-192172 | Drug Info | [551280] | |||
| AGN-193080 | Drug Info | [551280] | |||
| BMY-7378 | Drug Info | [527512] | |||
| CORYNANTHEINE | Drug Info | [533638] | |||
| FLUANISONE | Drug Info | [533378] | |||
| Imidazolidin-2-ylidene-o-tolyl-amine | Drug Info | [551280] | |||
| Imidazolidin-2-ylidene-quinoxalin-6-yl-amine | Drug Info | [551280] | |||
| INDORAMIN | Drug Info | [533682] | |||
| ISOCLOZAPINE | Drug Info | [534532] | |||
| LEVONORDEFRIN | Drug Info | [534160] | |||
| MAZAPERTINE | Drug Info | [533800] | |||
| MEDETOMIDINE | Drug Info | [533805] | |||
| N-(5-Bromo-quinoxalin-6-yl)-guanidine | Drug Info | [551280] | |||
| NIGULDIPINE | Drug Info | [533638] | |||
| OCTOCLOTHEPIN | Drug Info | [531171] | |||
| RWJ-38063 | Drug Info | [525785] | |||
| RWJ-68157 | Drug Info | [525785] | |||
| RWJ-69736 | Drug Info | [525785] | |||
| RX-821002 | Drug Info | [533375] | |||
| Siramesine | Drug Info | [533739] | |||
| SK&F-104078 | Drug Info | [533638] | |||
| SK&F-104856 | Drug Info | [533638] | |||
| SK&F-105854 | Drug Info | [533638] | |||
| SK&F-106686 | Drug Info | [533638] | |||
| SK&F-86466 | Drug Info | [533638] | |||
| SNAP-5089 | Drug Info | [533638] | |||
| SNAP-8719 | Drug Info | [527512] | |||
| Sunepitron | Drug Info | [528210] | |||
| TIOSPIRONE | Drug Info | [534093] | |||
| UH-301 | Drug Info | [534363] | |||
| WB-4101 | Drug Info | [533682] | |||
| Agonist | 4-Methoxyamphetamine | Drug Info | [551380] | ||
| Armodafinil | Drug Info | [544068], [550911] | |||
| Dabuzalgron | Drug Info | [540407] | |||
| SL-25.1039 | Drug Info | [550220] | |||
| Antagonist | Alfuzosin | Drug Info | [535396] | ||
| CR-2991 | Drug Info | [550128] | |||
| Doxazosin | Drug Info | [536929] | |||
| FIDUXOSIN HYDROCHLORIDE | Drug Info | [526250] | |||
| GYKI-16084 | Drug Info | [528199] | |||
| JTH-601 | Drug Info | [525752] | |||
| OPC-28326 | Drug Info | [525613] | |||
| Terazosin | Drug Info | [535079], [535647] | |||
| Modulator | Bunazosin | Drug Info | [527544], [551871] | ||
| Deriglidole | Drug Info | [534576] | |||
| DL-017 | Drug Info | [526190] | |||
| FCE-22716 | Drug Info | [533340] | |||
| Moxisylyte | Drug Info | [534246], [551871] | |||
| NS-49 | Drug Info | [525556] | |||
| Phenylephrine hydrochloride gel | Drug Info | [527269] | |||
| REC-15-2739 | Drug Info | [534138] | |||
| SL-89.0591 | Drug Info | [525538] | |||
| SL-91.0893 | Drug Info | [551953] | |||
| SOU-001 | Drug Info | [527154] | |||
| SUN-9221 | Drug Info | [525435] | |||
| Trimazosin | Drug Info | [533525], [551871] | |||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| cGMP-PKG signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| Adrenergic signaling in cardiomyocytes | |||||
| Vascular smooth muscle contraction | |||||
| Salivary secretion | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| Reactome | Adrenoceptors | ||||
| G alpha (q) signalling events | |||||
| G alpha (12/13) signalling events | |||||
| WikiPathways | Monoamine GPCRs | ||||
| Calcium Regulation in the Cardiac Cell | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| GPCRs, Other | |||||
| References | |||||
| Ref 468041 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 481). | ||||
| Ref 468083 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 487). | ||||
| Ref 468115 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 498). | ||||
| Ref 468117 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 499). | ||||
| Ref 468125 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 501). | ||||
| Ref 526190 | Antihypertensive action and blockade of alpha1-adrenoceptors by DL-017, a quinazoline derivative. J Cardiovasc Pharmacol. 2001 Dec;38(6):893-9. | ||||
| Ref 528210 | J Med Chem. 2006 Jun 1;49(11):3116-35.An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. | ||||
| Ref 529347 | Sedative and cardiopulmonary effects of medetomidine hydrochloride and xylazine hydrochloride and their reversal with atipamezole hydrochloride in calves. Am J Vet Res. 2008 Mar;69(3):319-29. | ||||
| Ref 533340 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | ||||
| Ref 536610 | Alpha blockers for the treatment of benign prostatic hyperplasia. Rev Urol. 2007 Fall;9(4):181-90. | ||||
| Ref 538289 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074823. | ||||
| Ref 538617 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101). | ||||
| Ref 540407 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3469). | ||||
| Ref 542116 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7109). | ||||
| Ref 542180 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7170). | ||||
| Ref 542324 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7302). | ||||
| Ref 543289 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 9). | ||||
| Ref 544511 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000010) | ||||
| Ref 544556 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000128) | ||||
| Ref 544626 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000354) | ||||
| Ref 544679 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562) | ||||
| Ref 544847 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001317) | ||||
| Ref 544924 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001560) | ||||
| Ref 545008 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001859) | ||||
| Ref 545183 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002398) | ||||
| Ref 545274 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
| Ref 545508 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003537) | ||||
| Ref 545536 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003628) | ||||
| Ref 545656 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004048) | ||||
| Ref 545699 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004255) | ||||
| Ref 545984 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005693) | ||||
| Ref 546178 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006767) | ||||
| Ref 546179 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006771) | ||||
| Ref 546240 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007056) | ||||
| Ref 546437 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008130) | ||||
| Ref 546856 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010685) | ||||
| Ref 546866 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010746) | ||||
| Ref 546957 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011559) | ||||
| Ref 547070 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012814) | ||||
| Ref 547205 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013967) | ||||
| Ref 547251 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014478) | ||||
| Ref 547287 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014859) | ||||
| Ref 547727 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018844) | ||||
| Ref 525435 | Synthesis and pharmacological evaluation of pyrroloazepine derivatives as potent antihypertensive agents with antiplatelet aggregation activity. Chem Pharm Bull (Tokyo). 1999 Feb;47(2):246-56. | ||||
| Ref 525538 | Effects of alpha1-adrenoceptor antagonists on agonist and tilt-induced changes in blood pressure: relationships to uroselectivity. Eur J Pharmacol. 1999 May 28;373(1):51-62. | ||||
| Ref 525556 | Pharmacokinetics of NS-49, a phenethylamine class alpha 1A-adrenoceptor agonist. 3rd communication: metabolism in rats, rabbits, dogs and monkeys, and effects on hepatic drug-metabolizing enzyme activities in rats after repeated administration. Arzneimittelforschung. 1999 Jul;49(7):612-7. | ||||
| Ref 525613 | Mechanisms of action of OPC-28326, a selective hindlimb vasodilator. J Pharmacol Exp Ther. 1999 Nov;291(2):604-11. | ||||
| Ref 525720 | J Med Chem. 2000 Mar 9;43(5):765-8.alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a high-affinity ligand for the alpha(2D) adrenergic receptor. | ||||
| Ref 525752 | Effect of JTH-601, a novel alpha(1)-adrenoceptor antagonist, on prostate function in dogs. Eur J Pharmacol. 2000 Apr 7;394(1):123-30. | ||||
| Ref 525785 | Bioorg Med Chem Lett. 2000 May 15;10(10):1093-6.Novel arylpiperazines as selective alpha1-adrenergic receptor antagonists. | ||||
| Ref 526190 | Antihypertensive action and blockade of alpha1-adrenoceptors by DL-017, a quinazoline derivative. J Cardiovasc Pharmacol. 2001 Dec;38(6):893-9. | ||||
| Ref 526250 | Effect of fiduxosin, an antagonist selective for alpha(1A)- and alpha(1D)-adrenoceptors, on intraurethral and arterial pressure responses in conscious dogs. J Pharmacol Exp Ther. 2002 Feb;300(2):487-94. | ||||
| Ref 526618 | Bioorg Med Chem Lett. 2003 May 19;13(10):1759-62.4-(3,4-dihydro-1H-isoquinolin-2yl)-pyridines and 4-(3,4-dihydro-1H-isoquinolin-2-yl)-quinolines as potent NR1/2B subtype selective NMDA receptor antagonists. | ||||
| Ref 526729 | J Med Chem. 1992 Mar 20;35(6):1009-18.Conformational effects on the activity of drugs. 13. A revision of previously proposed models for the activation of alpha- and beta-adrenergic receptors. | ||||
| Ref 526778 | J Med Chem. 1992 Oct 16;35(21):3845-57.Synthesis and hypoglycemic activity of substituted 8-(1-piperazinyl)imidazo[1,2-a]pyrazines. | ||||
| Ref 527154 | Drug repositioning: identifying and developing new uses for existing drugs. Nat Rev Drug Discov. 2004 Aug;3(8):673-83. | ||||
| Ref 527269 | Effects of topically instilled bunazosin, an alpha1-adrenoceptor antagonist, on constrictions induced by phenylephrine and ET-1 in rabbit retinal arteries. Invest Ophthalmol Vis Sci. 2004 Nov;45(11):4041-8. | ||||
| Ref 527512 | J Med Chem. 2005 Apr 21;48(8):3076-9.Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione as selective alpha(1d)-adrenergic receptor antagonists. | ||||
| Ref 527544 | Bunazosin, a selective alpha1-adrenoceptor antagonist, as an anti-glaucoma drug: effects on ocular circulation and retinal neuronal damage. Cardiovasc Drug Rev. 2005 Spring;23(1):43-56. | ||||
| Ref 527848 | Bioorg Med Chem Lett. 2006 Jan 15;16(2):257-61. Epub 2005 Nov 3.Design, synthesis, and vasorelaxant and platelet antiaggregatory activities of coumarin-resveratrol hybrids. | ||||
| Ref 528039 | J Med Chem. 1991 Jun;34(6):1850-4.Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. | ||||
| Ref 528062 | Bioorg Med Chem Lett. 2006 May 15;16(10):2786-90. Epub 2006 Mar 2.Vasorelaxant activity of phthalazinones and related compounds. | ||||
| Ref 528199 | A novel approach to the treatment of benign prostatic hyperplasia. BJU Int. 2006 Jun;97(6):1252-5. | ||||
| Ref 528210 | J Med Chem. 2006 Jun 1;49(11):3116-35.An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment of anxiety and depression. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531171 | J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for |A(1)-adrenoceptors. | ||||
| Ref 533340 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | ||||
| Ref 533375 | J Med Chem. 1986 Oct;29(10):2000-3.Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. | ||||
| Ref 533378 | J Med Chem. 1987 Nov;30(11):2099-104.2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. | ||||
| Ref 533509 | J Med Chem. 1984 Sep;27(9):1182-5.Adrenoceptor and tetrabenazine antagonism activities of some pyridinyltetrahydropyridines. | ||||
| Ref 533525 | The hypotensive effect of trimazosin is not caused solely by alpha 1-adrenoceptor blockade. J Cardiovasc Pharmacol. 1984 Jan-Feb;6(1):142-50. | ||||
| Ref 533638 | J Med Chem. 1995 Sep 15;38(19):3681-716.Alpha- and beta-adrenoceptors: from the gene to the clinic. 2. Structure-activity relationships and therapeutic applications. | ||||
| Ref 533682 | J Med Chem. 1995 Sep 1;38(18):3415-44.Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. | ||||
| Ref 533739 | J Med Chem. 1995 May 26;38(11):1998-2008.Sigma ligands with subnanomolar affinity and preference for the sigma 2 binding site. 1. 3-(omega-aminoalkyl)-1H-indoles. | ||||
| Ref 533800 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
| Ref 533805 | J Med Chem. 1994 Jul 22;37(15):2328-33.A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic receptors. | ||||
| Ref 534093 | J Med Chem. 1996 Jan 5;39(1):143-8.3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. | ||||
| Ref 534138 | Functional antagonistic activity of Rec 15/2739, a novel alpha-1 antagonist selective for the lower urinary tract, on noradrenaline-induced contraction of human prostate and mesenteric artery. J Pharmacol Exp Ther. 1996 Jun;277(3):1237-46. | ||||
| Ref 534160 | J Med Chem. 1996 Jul 19;39(15):3001-13.Medetomidine analogs as alpha 2-adrenergic ligands. 2. Design, synthesis, and biological activity of conformationally restricted naphthalene derivatives of medetomidine. | ||||
| Ref 534246 | Pharmacokinetics of moxisylyte in healthy volunteers after intracavernous injection of increasing doses. Eur J Clin Pharmacol. 1996;49(5):411-5. | ||||
| Ref 534315 | J Med Chem. 1997 Jan 3;40(1):18-23.Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. | ||||
| Ref 534363 | J Med Chem. 1997 Apr 11;40(8):1252-7.N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. | ||||
| Ref 534467 | J Med Chem. 1997 Sep 12;40(19):3014-24.Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potential binding interactions with alpha 2-adrenoceptors involving a "methyl pocket". | ||||
| Ref 534532 | J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. | ||||
| Ref 534576 | Mechanisms of the hypoglycemic effects of the alpha2-adrenoceptor antagonists SL84.0418 and deriglidole. Life Sci. 1998;62(9):839-52. | ||||
| Ref 535079 | Overexpression of the alpha1B-adrenergic receptor causes apoptotic neurodegeneration: multiple system atrophy. Nat Med. 2000 Dec;6(12):1388-94. | ||||
| Ref 535396 | Alfuzosin: a review of the therapeutic use of the prolonged-release formulation given once daily in the management of benign prostatic hyperplasia. Drugs. 2002;62(4):633-53. | ||||
| Ref 535647 | Induction of prostate apoptosis by alpha1-adrenoceptor antagonists: mechanistic significance of the quinazoline component. Prostate Cancer Prostatic Dis. 2002;5(2):88-95. | ||||
| Ref 536929 | The role of combination medical therapy in benign prostatic hyperplasia. Int J Impot Res. 2008 Dec;20 Suppl 3:S33-43. | ||||
| Ref 540407 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3469). | ||||
| Ref 544068 | Mechanisms of modafinil: A review of current research. Neuropsychiatr Dis Treat. 2007 June; 3(3): 349-364. | ||||
| Ref 550128 | WO patent application no. 2006,1244,90, Heterocycles as nicotinic acid receptor agonists for the treatment of dyslipidemia. | ||||
| Ref 550911 | US patent application no. 2014,0349,964, Methods for inducing orexin neurons and agent for treating narcolepsy or eating disorder. | ||||
| Ref 551280 | Analogs of UK 14,304: Structural features responsible for alpha2 adrenoceptor activity, Bioorg. Med. Chem. Lett. 5(15):1745-1750 (1995). | ||||
| Ref 551380 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
