Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEO1IE3)

DME Name Cytochrome P450 3A43 (CYP3A43)
Synonyms Cytochrome P450 family 3 subfamily A member 43; CYP3A43; OMIM: 606534; HomoloGene: 136124; GeneCards: CYP3A43
Gene Name CYP3A43
UniProt ID
CP343_HUMAN
INTEDE ID
DME0022
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
64816
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNF
DRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSF
AEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYT
MDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFEALNIGL
FPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSI
IIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVV
NETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFS
KKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNL
PILQPEKPIVLKVHLRDGITSGP
Function This enzyme exhibits low testosterone 6-beta-hydroxylase activity.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Reactome Pathway
Xenobiotics (R-HSA-211981 )
Miscellaneous substrates (R-HSA-211958 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
5 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethosuximide DMDZ9LT Epilepsy 8A60-8A68 Approved [1]
Oxazepam DMXNZM4 Alcohol withdrawal delirium Approved [2]
Praziquantel DMOU1PK Flatworm infection 1F70-1F86 Approved [3]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [4]
Zalcitabine DMH7MUV Human immunodeficiency virus infection 1C62 Approved [5]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.41E-01 -2.71E-02 -1.53E-01
Alopecia ED70 Skin from scalp 2.12E-01 2.34E-02 1.24E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.55E-01 -2.09E-02 -1.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.30E-01 -5.06E-02 -6.80E-01
Aortic stenosis BB70 Calcified aortic valve 7.91E-01 -2.21E-01 -3.78E-01
Apnea 7A40 Hyperplastic tonsil 7.61E-01 1.90E-01 4.83E-01
Arthropathy FA00-FA5Z Peripheral blood 3.99E-01 6.10E-02 4.31E-01
Asthma CA23 Nasal and bronchial airway 4.67E-01 9.65E-02 3.17E-01
Atopic dermatitis EA80 Skin 7.56E-01 -6.60E-02 -4.22E-01
Autism 6A02 Whole blood 4.99E-01 -1.75E-02 -1.02E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.73E-02 -1.45E-01 -9.75E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.75E-01 -4.73E-02 -3.56E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.31E-04 -1.67E-01 -4.56E-01
Batten disease 5C56.1 Whole blood 5.04E-01 9.19E-04 1.35E-02
Behcet's disease 4A62 Peripheral blood 1.97E-01 1.08E-01 4.99E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.01E-02 -8.15E-02 -6.45E-01
Bladder cancer 2C94 Bladder tissue 3.12E-07 5.36E-01 4.67E+00
Breast cancer 2C60-2C6Z Breast tissue 1.38E-07 -1.30E-01 -4.48E-01
Cardioembolic stroke 8B11.20 Whole blood 3.87E-02 -1.16E-01 -1.03E+00
Cervical cancer 2C77 Cervical tissue 6.43E-03 -1.28E-01 -4.05E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.30E-01 8.44E-02 4.98E-01
Chronic hepatitis C 1E51.1 Whole blood 4.01E-02 1.06E-01 7.96E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.02E-01 4.79E-02 1.81E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.34E-01 -3.03E-02 -2.18E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.48E-02 8.44E-02 6.67E-01
Colon cancer 2B90 Colon tissue 3.75E-07 -1.58E-01 -5.08E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.78E-01 -4.02E-02 -3.45E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.35E-01 6.20E-02 5.96E-01
Endometriosis GA10 Endometrium tissue 5.48E-02 1.92E-01 9.66E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.87E-01 -7.65E-02 -5.67E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.51E-04 -2.90E-01 -1.40E+00
Gastric cancer 2B72 Gastric tissue 3.70E-01 -7.36E-02 -1.52E-01
Glioblastopma 2A00.00 Nervous tissue 1.20E-01 -1.31E-02 -5.18E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.84E-01 6.82E-02 1.16E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.24E-02 -3.69E-01 -1.17E+00
Head and neck cancer 2D42 Head and neck tissue 3.50E-04 -1.01E-01 -3.66E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.31E-01 -3.13E-02 -9.39E-02
Huntington's disease 8A01.10 Whole blood 5.94E-01 -3.81E-03 -4.02E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.87E-01 -1.62E-01 -7.29E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.64E-01 6.98E-02 9.64E-01
Influenza 1E30 Whole blood 9.18E-01 -4.89E-02 -5.46E-01
Interstitial cystitis GC00.3 Bladder tissue 7.79E-03 -2.63E-01 -1.76E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.84E-01 8.05E-02 7.39E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.06E-01 1.06E-02 4.77E-02
Ischemic stroke 8B11 Peripheral blood 3.22E-01 4.62E-02 3.63E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.78E-02 3.78E-02 1.92E-01
Lateral sclerosis 8B60.4 Skin 2.49E-01 1.08E-01 7.95E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.31E-01 1.15E-01 9.40E-01
Liver cancer 2C12.0 Liver tissue 2.61E-08 -1.76E+00 -1.38E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.99E-03 -2.14E+00 -1.80E+00
Lung cancer 2C25 Lung tissue 2.01E-26 -2.09E-01 -1.06E+00
Lupus erythematosus 4A40 Whole blood 4.48E-01 -1.07E-01 -3.02E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.75E-01 -1.52E-02 -1.14E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.65E-01 1.40E-02 5.85E-02
Melanoma 2C30 Skin 3.83E-02 -3.13E-01 -5.53E-01
Multiple myeloma 2A83.1 Peripheral blood 2.30E-01 7.77E-02 4.98E-01
Multiple myeloma 2A83.1 Bone marrow 2.57E-03 -4.73E-01 -1.97E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.00E-01 2.25E-01 5.94E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.85E-01 3.82E-02 2.05E-01
Myelofibrosis 2A20.2 Whole blood 1.56E-01 5.24E-02 4.48E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.50E-01 1.12E-01 3.19E-01
Myopathy 8C70.6 Muscle tissue 3.24E-01 -9.50E-02 -1.03E+00
Neonatal sepsis KA60 Whole blood 1.16E-04 -1.23E-01 -6.72E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.06E-04 -6.92E-01 -1.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.46E-01 -1.80E-01 -1.95E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.13E-01 -5.12E-02 -6.29E-01
Olive pollen allergy CA08.00 Peripheral blood 2.76E-01 7.22E-02 2.07E+00
Oral cancer 2B6E Oral tissue 4.54E-07 -4.93E-01 -1.38E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.62E-01 3.34E-02 7.06E-02
Osteoporosis FB83.1 Bone marrow 4.76E-03 3.63E-01 3.75E+00
Ovarian cancer 2C73 Ovarian tissue 7.97E-01 -1.30E-02 -3.53E-02
Pancreatic cancer 2C10 Pancreas 3.60E-02 1.54E-01 4.91E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.14E-01 6.39E-02 4.34E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.81E-01 -1.15E-02 -1.26E-01
Pituitary cancer 2D12 Pituitary tissue 1.74E-01 -1.02E-01 -4.26E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.61E-03 -2.55E-01 -1.26E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.69E-02 1.45E-01 1.15E+00
Polycythemia vera 2A20.4 Whole blood 3.27E-02 2.65E-02 2.52E-01
Pompe disease 5C51.3 Biceps muscle 4.29E-01 -1.06E-02 -7.32E-02
Preterm birth KA21.4Z Myometrium 6.90E-01 -2.93E-02 -3.09E-01
Prostate cancer 2C82 Prostate 1.02E-04 -7.74E-01 -1.41E+00
Psoriasis EA90 Skin 4.22E-05 -8.13E-02 -3.55E-01
Rectal cancer 2B92 Rectal colon tissue 5.20E-01 1.15E-01 5.03E-01
Renal cancer 2C90-2C91 Kidney 3.65E-01 -9.57E-02 -3.44E-01
Retinoblastoma 2D02.2 Uvea 3.74E-06 -2.48E-01 -2.90E+00
Rheumatoid arthritis FA20 Synovial tissue 9.92E-03 2.91E-01 1.73E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.81E-01 3.21E-03 2.45E-02
Schizophrenia 6A20 Prefrontal cortex 5.13E-01 2.05E-02 8.47E-02
Schizophrenia 6A20 Superior temporal cortex 1.41E-01 -6.48E-02 -7.21E-01
Scleroderma 4A42.Z Whole blood 9.95E-03 -1.22E-01 -1.36E+00
Seizure 8A60-8A6Z Whole blood 9.71E-01 -7.92E-02 -5.60E-01
Sensitive skin EK0Z Skin 4.56E-01 -4.15E-02 -2.75E-01
Sepsis with septic shock 1G41 Whole blood 8.83E-03 -2.17E-02 -1.05E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.18E-02 5.70E-01 1.51E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.26E-03 2.00E-01 1.39E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.17E-01 1.64E-01 1.48E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.03E-01 3.53E-02 3.44E-01
Skin cancer 2C30-2C3Z Skin 3.24E-27 -3.68E-01 -1.18E+00
Thrombocythemia 3B63 Whole blood 9.07E-01 7.08E-02 5.30E-01
Thrombocytopenia 3B64 Whole blood 7.40E-01 -4.69E-02 -4.12E-01
Thyroid cancer 2D10 Thyroid 6.46E-01 2.09E-02 1.15E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.03E-01 2.73E-02 1.81E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.64E-01 6.86E-02 2.90E-01
Type 2 diabetes 5A11 Liver tissue 3.44E-01 -1.58E-01 -3.31E-01
Ureter cancer 2C92 Urothelium 5.88E-01 -2.49E-02 -1.86E-01
Uterine cancer 2C78 Endometrium tissue 3.08E-03 -1.22E-01 -3.08E-01
Vitiligo ED63.0 Skin 4.94E-01 -5.61E-02 -2.08E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
2 Cytochrome P450 enzyme activity and protein expression in primary porcine enterocyte and hepatocyte cultures. Xenobiotica. 2000 Jan;30(1):27-46.
3 Rifampin markedly decreases plasma concentrations of praziquantel in healthy volunteers. Clin Pharmacol Ther. 2002 Nov;72(5):505-13.
4 cDNA cloning and initial characterization of CYP3A43, a novel human cytochrome P450. Mol Pharmacol. 2001 Feb;59(2):386-92.
5 Protease inhibitors in patients with HIV disease. Clinically important pharmacokinetic considerations. Clin Pharmacokinet. 1997 Mar;32(3):194-209.