Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEZS5YK)

DME Name Estradiol 17-beta-dehydrogenase 1 (HSD17B1)
Synonyms
Placental 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 28C member 1; 17-beta-HSD 1; 17-beta-hydroxysteroid dehydrogenase type 1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E17KSR; EDH17B1; EDHB17; HSD17B1; SDR28C1
Gene Name HSD17B1
UniProt ID
DHB1_HUMAN
INTEDE ID
DME0420
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3292
EC Number EC: 1.1.1.62
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.62
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Function This enzyme favors the reduction of estrogens and androgens. It also has 20- alpha-HSD activity.
KEGG Pathway
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902 )
Estrogen biosynthesis (R-HSA-193144 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [10]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.55E-04 1.09E-01 3.39E-01
Alopecia ED70 Skin from scalp 7.55E-01 -1.08E-02 -3.01E-02
Alzheimer's disease 8A20 Entorhinal cortex 8.14E-01 -4.78E-02 -2.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.22E-01 2.02E-01 1.19E+00
Aortic stenosis BB70 Calcified aortic valve 3.33E-01 -1.22E-01 -6.69E-01
Apnea 7A40 Hyperplastic tonsil 2.34E-02 -8.56E-01 -4.12E+00
Arthropathy FA00-FA5Z Peripheral blood 3.47E-01 -9.20E-02 -5.07E-01
Asthma CA23 Nasal and bronchial airway 1.36E-01 1.66E-01 3.62E-01
Atopic dermatitis EA80 Skin 4.58E-04 4.18E-01 2.56E+00
Autism 6A02 Whole blood 1.17E-01 -5.15E-02 -3.01E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.80E-01 7.17E-02 7.67E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.99E-01 -1.04E-01 -3.73E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.64E-07 -3.01E-01 -1.02E+00
Batten disease 5C56.1 Whole blood 4.91E-01 5.83E-02 4.79E-01
Behcet's disease 4A62 Peripheral blood 5.25E-01 -5.44E-02 -3.79E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.38E-01 -3.75E-02 -3.12E-01
Bladder cancer 2C94 Bladder tissue 1.99E-02 1.64E-01 1.37E+00
Breast cancer 2C60-2C6Z Breast tissue 4.27E-02 2.68E-02 4.68E-02
Cardioembolic stroke 8B11.20 Whole blood 1.42E-02 1.19E-01 6.80E-01
Cervical cancer 2C77 Cervical tissue 1.27E-01 -1.54E-01 -5.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.65E-02 -1.19E-01 -7.94E-01
Chronic hepatitis C 1E51.1 Whole blood 7.47E-01 -2.63E-02 -1.30E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.40E-01 -3.36E-02 -2.07E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.20E-01 5.99E-04 3.72E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.06E-01 5.83E-02 3.97E-01
Colon cancer 2B90 Colon tissue 1.93E-16 1.58E-01 7.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.23E-01 7.22E-02 1.66E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.10E-01 -3.63E-01 -2.36E+00
Endometriosis GA10 Endometrium tissue 7.68E-01 -1.53E-02 -2.75E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.90E-02 7.81E-02 7.27E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.37E-03 1.97E-01 1.37E+00
Gastric cancer 2B72 Gastric tissue 9.83E-03 5.33E-01 3.78E+00
Glioblastopma 2A00.00 Nervous tissue 6.16E-13 1.20E-01 4.72E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.46E-01 -3.06E-01 -5.83E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.16E-01 2.01E-02 4.65E-02
Head and neck cancer 2D42 Head and neck tissue 7.01E-13 3.20E-01 1.34E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.37E-01 7.36E-02 2.61E-01
Huntington's disease 8A01.10 Whole blood 4.30E-01 -1.45E-01 -7.25E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.19E-01 3.09E-02 2.08E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.94E-01 -1.56E-02 -1.32E-01
Influenza 1E30 Whole blood 2.47E-04 -3.45E-01 -6.62E+00
Interstitial cystitis GC00.3 Bladder tissue 1.30E-02 -2.16E-01 -1.38E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.36E-01 1.64E-01 7.88E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.03E-01 -4.99E-02 -1.67E-01
Ischemic stroke 8B11 Peripheral blood 5.02E-01 -6.99E-02 -4.09E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.05E-04 -1.75E-01 -4.80E-01
Lateral sclerosis 8B60.4 Skin 1.28E-01 -1.69E-01 -7.96E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.46E-01 6.84E-02 2.15E-01
Liver cancer 2C12.0 Liver tissue 2.82E-01 -8.19E-03 -2.77E-02
Liver failure DB99.7-DB99.8 Liver tissue 6.46E-01 1.46E-02 4.30E-02
Lung cancer 2C25 Lung tissue 1.80E-113 5.15E-01 2.49E+00
Lupus erythematosus 4A40 Whole blood 4.35E-01 1.06E-03 3.33E-03
Major depressive disorder 6A70-6A7Z Hippocampus 8.07E-01 -2.65E-02 -2.47E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.92E-01 -1.86E-03 -5.37E-03
Melanoma 2C30 Skin 3.39E-02 2.15E-01 4.14E-01
Multiple myeloma 2A83.1 Peripheral blood 3.77E-01 -7.58E-02 -3.96E-01
Multiple myeloma 2A83.1 Bone marrow 2.99E-05 3.52E-01 2.45E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.49E-02 -2.13E-01 -1.32E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.09E-03 1.48E-01 8.02E-01
Myelofibrosis 2A20.2 Whole blood 1.99E-01 5.62E-02 5.68E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.85E-01 -1.88E-01 -3.40E-01
Myopathy 8C70.6 Muscle tissue 6.31E-01 -2.81E-02 -1.87E-01
Neonatal sepsis KA60 Whole blood 9.76E-02 -2.01E-02 -9.45E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.39E-08 6.81E-01 3.66E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.49E-01 -1.08E-01 -5.05E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.61E-01 1.62E-01 9.10E-01
Olive pollen allergy CA08.00 Peripheral blood 6.54E-01 -6.48E-03 -3.92E-02
Oral cancer 2B6E Oral tissue 6.72E-02 3.76E-01 5.57E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.26E-01 2.05E-01 7.24E-01
Osteoporosis FB83.1 Bone marrow 1.37E-01 1.25E-01 1.33E+00
Ovarian cancer 2C73 Ovarian tissue 9.40E-01 8.68E-02 2.17E-01
Pancreatic cancer 2C10 Pancreas 2.17E-03 1.69E-01 7.78E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.71E-03 2.81E-01 1.32E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.40E-01 6.03E-03 3.63E-02
Pituitary cancer 2D12 Pituitary tissue 5.31E-01 -9.80E-02 -4.04E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.27E-01 -1.43E-01 -7.29E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.36E-01 -1.64E-02 -2.32E-01
Polycythemia vera 2A20.4 Whole blood 1.11E-03 1.40E-02 1.23E-01
Pompe disease 5C51.3 Biceps muscle 3.36E-03 2.60E-01 1.52E+00
Preterm birth KA21.4Z Myometrium 5.10E-01 3.98E-02 8.41E-02
Prostate cancer 2C82 Prostate 1.49E-02 1.44E-01 3.14E-01
Psoriasis EA90 Skin 1.21E-04 9.42E-02 2.39E-01
Rectal cancer 2B92 Rectal colon tissue 3.56E-02 -3.13E-01 -1.42E+00
Renal cancer 2C90-2C91 Kidney 5.45E-01 -4.51E-02 -2.21E-01
Retinoblastoma 2D02.2 Uvea 5.55E-07 6.00E-01 4.25E+00
Rheumatoid arthritis FA20 Synovial tissue 9.57E-01 1.58E-01 5.02E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.34E-01 2.88E-02 2.50E-01
Schizophrenia 6A20 Prefrontal cortex 2.24E-01 -3.18E-03 -1.65E-02
Schizophrenia 6A20 Superior temporal cortex 3.52E-01 -2.39E-02 -2.03E-01
Scleroderma 4A42.Z Whole blood 2.28E-01 9.88E-02 7.92E-01
Seizure 8A60-8A6Z Whole blood 7.74E-01 -6.11E-05 -3.77E-04
Sensitive skin EK0Z Skin 9.77E-01 -2.81E-02 -1.36E-01
Sepsis with septic shock 1G41 Whole blood 2.80E-03 6.64E-02 3.34E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.45E-01 -6.18E-02 -2.99E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.50E-03 -2.60E-01 -2.06E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.61E-01 1.39E-01 4.41E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.47E-01 -5.84E-01 -1.54E+00
Skin cancer 2C30-2C3Z Skin 2.06E-03 -2.51E-01 -6.02E-01
Thrombocythemia 3B63 Whole blood 7.33E-04 7.40E-02 7.42E-01
Thrombocytopenia 3B64 Whole blood 6.00E-01 4.73E-02 5.43E-02
Thyroid cancer 2D10 Thyroid 2.65E-11 -3.00E-01 -1.06E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.19E-01 -3.50E-02 -1.64E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.39E-01 -7.12E-02 -3.77E-01
Type 2 diabetes 5A11 Liver tissue 5.03E-02 -8.80E-02 -6.92E-01
Ureter cancer 2C92 Urothelium 7.98E-01 -4.22E-02 -2.32E-01
Uterine cancer 2C78 Endometrium tissue 2.45E-04 -1.69E-01 -2.16E-01
Vitiligo ED63.0 Skin 1.32E-01 1.78E-01 6.49E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
NARINGENIN DMHAZLM N. A. N. A. Phase 1 [1]
102 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,1':4',1''-terphenyl-3,3''-diol DMGHAC7 Discovery agent N.A. Investigative [2]
1,1':4',1''-terphenyl-3,4''-diol DMA3LZ9 Discovery agent N.A. Investigative [2]
1-Bromo-6-(3-hydroxyphenyl)-2-naphthol DMU2PSQ Discovery agent N.A. Investigative [3]
16-(2',2'-Dimethyl)-propylidene-estradiol DMK4N2F Discovery agent N.A. Investigative [4]
16-(2',2'-Dimethyl)-propylidene-estrone DMQYJB1 Discovery agent N.A. Investigative [4]
16-(4-cyano-benzylidene)-estradiol DMTAXZI Discovery agent N.A. Investigative [4]
16-(4-dimethylamino-benzylidene)-estradiol DMEH8I0 Discovery agent N.A. Investigative [4]
16-(4-dimethylamino-benzylidene)-estrone DMX8YCK Discovery agent N.A. Investigative [4]
16-(pyridin-2-yl)methyl-estradiol DMSXFG0 Discovery agent N.A. Investigative [4]
16-(pyridin-2-yl)methylene-estradiol DMIC0OU Discovery agent N.A. Investigative [4]
16-(pyridin-3-yl)methyl-estradiol DMTD5AO Discovery agent N.A. Investigative [4]
16-(pyridin-3-yl)methylene-estradiol DMIMZ21 Discovery agent N.A. Investigative [4]
16-(pyridin-4-yl)methyl-estradiol DM7NSRI Discovery agent N.A. Investigative [4]
16-(pyridin-4-yl)methylene-estradiol DMOTNPC Discovery agent N.A. Investigative [4]
16-(thiophen-2-yl)methylene-estrone DME3XS4 Discovery agent N.A. Investigative [4]
16-beta-ethoxymethyl-estrone DMWJNV5 Discovery agent N.A. Investigative [4]
16-beta-hydroxymethyl-estradiol DMUW07J Discovery agent N.A. Investigative [4]
16-isobutylidene-estradiol DMTZG68 Discovery agent N.A. Investigative [4]
16-isobutylidene-estrone DMS7PL3 Discovery agent N.A. Investigative [4]
16beta-cyano-estradiol DMCMP9B Discovery agent N.A. Investigative [4]
2'-Monophosphoadenosine 5'-Diphosphoribose DME9S8M Discovery agent N.A. Investigative [5]
2-(3-hydroxyphenyl)quinolin-6-ol DMV9M57 Discovery agent N.A. Investigative [6]
2-Fluoro-4-[5-(3-hydroxyphenyl)-2-thienyl]phenol DMUGAT8 Discovery agent N.A. Investigative [2]
2-Fluoro-4-[5-(3-hydroxyphenyl)-3-thienyl]phenol DMGBEFY Discovery agent N.A. Investigative [2]
2-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol DMKOUCM Discovery agent N.A. Investigative [2]
2-Hydroxy-N,6-bis(3-hydroxyphenyl)-1-naphthamide DMQ0F96 Discovery agent N.A. Investigative [3]
3'-(1-Benzothien-2-yl)biphenyl-3-ol DMSZLNE Discovery agent N.A. Investigative [7]
3'-(5-Chloro-2-thienyl)biphenyl-3-ol DMM4HF8 Discovery agent N.A. Investigative [7]
3,3',3''-Thiene-2,3,5-triyltriphenol DMH7A32 Discovery agent N.A. Investigative [2]
3,3'-(1,2,4,5-tetrazine-3,6-diyl)diphenol DM9GO8Y Discovery agent N.A. Investigative [8]
3,3'-(1,2,4-Thiadiazol-2,5-diyl)diphenol DM4O2VC Discovery agent N.A. Investigative [8]
3,3'-(1,2,4-thiadiazole-3,5-diyl)diphenol DMC34UW Discovery agent N.A. Investigative [8]
3,3'-(1,3-Thiazol-2,4-diyl)diphenol DM9AJNW Discovery agent N.A. Investigative [8]
3,3'-(3-Methylthiene-2,5-diyl]diphenol DM40SNY Discovery agent N.A. Investigative [2]
3,3'-(3-Phenylthiene-2,5-diyl)diphenol DMUK1VX Discovery agent N.A. Investigative [2]
3,3'-pyrazine-2,5-diyldiphenol DMZTIPJ Discovery agent N.A. Investigative [8]
3,3'-Pyridine-2,5-diyldiphenol DMZILNC Discovery agent N.A. Investigative [8]
3,3'-Thiene-2,4-diyldiphenol DMW7XFQ Discovery agent N.A. Investigative [8]
3,3'-thiene-2,5-diyldiphenol DMWH0ER Discovery agent N.A. Investigative [2]
3,3-(1,3-Thiazole-2,5-diyl)diphenol DMQY50A Discovery agent N.A. Investigative [8]
3,4'-(thiophene-2,4-diyl)diphenol DMEN9T4 Discovery agent N.A. Investigative [2]
3-(2-naphthyl)phenol DM27HSO Discovery agent N.A. Investigative [6]
3-(3-hydroxyphenyl)quinolin-7-ol DMP0DQE Discovery agent N.A. Investigative [6]
3-(5-phenyl-2-thienyl)phenol DM5NIE7 Discovery agent N.A. Investigative [2]
3-(6-hydroxy-2-naphthyl)benzoic acid DMTIKF7 Discovery agent N.A. Investigative [6]
3-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol DMDPY9N Discovery agent N.A. Investigative [2]
3-Hydroxy-7-(3-hydroxyphenyl)-1-naphthonitrile DM3SOFX Discovery agent N.A. Investigative [3]
3-[2-(5-Chloro-2-thienyl)pyridin-4-yl]phenol DM5EJLD Discovery agent N.A. Investigative [7]
3-[3-(4-hydroxyphenyl)isoxazol-5-yl]phenol DMNC6W9 Discovery agent N.A. Investigative [9]
3-[4-(4-Hydroxyphenyl)-1,3-oxazol-2-yl]phenol DMIM5WE Discovery agent N.A. Investigative [9]
3-[4-(5-Chloro-2-thienyl)pyridin-2-yl]phenol DMZCO83 Discovery agent N.A. Investigative [7]
3-[5-(3,4-Difluorophenyl)-2-thienyl]phenol DMYZIG3 Discovery agent N.A. Investigative [2]
3-[5-(3-Fluorophenyl)-2-thienyl]phenol DMD5QOW Discovery agent N.A. Investigative [2]
3-[5-(4-Fluorophenyl)-2-thienyl]phenol DMYZ2U0 Discovery agent N.A. Investigative [2]
3-[5-(4-hydroxyphenyl)-1,3-oxazol-2-yl]phenol DM4TFMA Discovery agent N.A. Investigative [8]
3-[5-(4-hydroxyphenyl)-1,3-thiazol-2-yl]phenol DM2IXO0 Discovery agent N.A. Investigative [2]
3-[5-(4-Hydroxyphenyl)-2-thienyl]-5-methylphenol DMAMOJE Discovery agent N.A. Investigative [2]
3-[5-(4-hydroxyphenyl)-2-thienyl]phenol DMSFW9T Discovery agent N.A. Investigative [2]
3-[5-(4-Hydroxyphenyl)-3-thienyl]phenol DM40GJ8 Discovery agent N.A. Investigative [8]
3-[6-(5-Chloro-2-thienyl)pyridin-2-yl]phenol DMLTZ5F Discovery agent N.A. Investigative [7]
4'-(5-Chloro-2-thienyl)biphenyl-3-ol DMDYBIC Discovery agent N.A. Investigative [7]
4'-(6-Methoxypyridin-3-yl)biphenyl-3-ol DM4B73F Discovery agent N.A. Investigative [7]
4-ANDROSTENE-3-17-DIONE DMSE8NU Discovery agent N.A. Investigative [5]
4-Fluoro-1,1':4',1''-terphenyl-3,3''-diol DM0INZX Discovery agent N.A. Investigative [2]
4-Methyl-1,1':4',1''-terphenyl-3,4''-diol DM2IZA3 Discovery agent N.A. Investigative [2]
4-[5-(3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol DMK4ICB Discovery agent N.A. Investigative [2]
4-[5-(3-Hydroxyphenyl)-2-thienyl]benzene-1,2-diol DMZHVFO Discovery agent N.A. Investigative [2]
4-[5-(3-Hydroxyphenyl)-3-thienyl]-2-methylphenol DM7ERYJ Discovery agent N.A. Investigative [2]
5-(6-hydroxy-2-naphthyl)pyridin-3-ol DMJWIPS Discovery agent N.A. Investigative [6]
5alpha-Androstan-3,17-Dione DMHI7Y2 Discovery agent N.A. Investigative [5]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol DMH8WA2 Discovery agent N.A. Investigative [3]
6-(3-Hydroxyphenyl)-1-phenyl-2-naphthol DMMZENV Discovery agent N.A. Investigative [3]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol DM2V9XI Discovery agent N.A. Investigative [6]
6-oxo-16-formyl-estrone DMPBE5H Discovery agent N.A. Investigative [4]
6-oxo-estrone DMKMYAJ Discovery agent N.A. Investigative [4]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol DM2I91C Discovery agent N.A. Investigative [6]
7-Hydroxy-3-(3-hydroxyphenyl)-1-naphthonitrile DMS2NZA Discovery agent N.A. Investigative [3]
APIGENIN DMI3491 Discovery agent N.A. Investigative [1]
EM-1745 DM3RSYO Discovery agent N.A. Investigative [5]
Ethyl estrone-16-methylcarboxylate DMXTLJE Discovery agent N.A. Investigative [4]
KAEMPFEROL DMHEMUB Discovery agent N.A. Investigative [1]
Methyl estradiol-16-beta-carboxylate DMG8XD1 Discovery agent N.A. Investigative [4]
N,N-diethyl estrone-16-methyl carboxamide DMZ3EA1 Discovery agent N.A. Investigative [4]
N-(1'-Phenyl-ethyl) estradiol-16-carboxamide DM6DEZ4 Discovery agent N.A. Investigative [4]
N-(4'-methyl-piperazinyl) estradiol-16-carboxamide DMXNMTD Discovery agent N.A. Investigative [4]
N-(furan-2-ylmethyl)-estrone-16-methyl carboxamide DM0DZ9J Discovery agent N.A. Investigative [4]
N-(furan-2-ylmethyl)estradiol-16-carboxamide DMLJZGD Discovery agent N.A. Investigative [4]
N-(pyridin-3-ylmethyl) estradiol-16-carboxamide DMBJKH1 Discovery agent N.A. Investigative [4]
N-(pyridin-4-ylmethyl) estradiol-16-carboxamide DMYFAQV Discovery agent N.A. Investigative [4]
N-ethyl estradiol-16-methyl carboxamide DM1W2GZ Discovery agent N.A. Investigative [4]
N-ethyl estrone-16-methyl carboxamide DMM9526 Discovery agent N.A. Investigative [4]
N-isopropyl estradiol-16-carboxamide DMFSW5M Discovery agent N.A. Investigative [4]
N-isopropyl estradiol-16-methyl carboxamide DMHJMTI Discovery agent N.A. Investigative [4]
N-isopropyl estrone-16-methyl carboxamide DMZGMQJ Discovery agent N.A. Investigative [4]
N-methoxyethyl estrone-16-methyl carboxamide DMI9QRO Discovery agent N.A. Investigative [4]
N-methyl estradiol-16-methyl carboxamide DM32YID Discovery agent N.A. Investigative [4]
N-methyl estrone-16-methyl carboxamide DM7XIK5 Discovery agent N.A. Investigative [4]
N-methyl-N-ethyl estradiol-16-carboxamide DM6DM4L Discovery agent N.A. Investigative [4]
N-methyl-N-ethyl estrone-16-methyl carboxamide DM2CUEB Discovery agent N.A. Investigative [4]
N-N-diethyl estradiol-16-methyl carboxamide DMUHZ23 Discovery agent N.A. Investigative [4]
Nicotinamide-Adenine-Dinucleotide DM9LRKB N. A. N. A. Investigative [5]
NSC-94258 DM6VY3P Discovery agent N.A. Investigative [1]
⏷ Show the Full List of 102 Investigative Drug(s)
1 Investigative Agents Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Equilin DM2Q19U Coronavirus Disease 2019 (COVID-19) 1D6Y Investigative [5]

References

1 Discovery of nonsteroidal 17beta-hydroxysteroid dehydrogenase 1 inhibitors by pharmacophore-based screening of virtual compound libraries. J Med Chem. 2008 Jul 24;51(14):4188-99.
2 New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxyst... J Med Chem. 2009 Nov 12;52(21):6724-43.
3 Substituted 6-phenyl-2-naphthols. Potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1): design,... J Med Chem. 2008 Aug 14;51(15):4685-98.
4 Modification of estrone at the 6, 16, and 17 positions: novel potent inhibitors of 17beta-hydroxysteroid dehydrogenase type 1. J Med Chem. 2006 Feb 23;49(4):1325-45.
5 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
6 Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors... J Med Chem. 2008 Apr 10;51(7):2158-69.
7 Novel estrone mimetics with high 17beta-HSD1 inhibitory activity. Bioorg Med Chem. 2010 May 15;18(10):3494-505.
8 Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as p... J Med Chem. 2008 Nov 13;51(21):6725-39.
9 Design, synthesis and biological evaluation of bis(hydroxyphenyl) azoles as potent and selective non-steroidal inhibitors of 17beta-hydroxysteroid ... Bioorg Med Chem. 2008 Jun 15;16(12):6423-35.
10 Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.