Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIWB6L)

• DTT Name: Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1)
• Synonyms: Short chain dehydrogenase/reductase family 28C member 1; SDR28C1; Placental 17-beta-hydroxysteroid dehydrogenase; Estradiol 17-beta-dehydrogenase 1; EDHB17; EDH17B2; EDH17B1; E2DH; E17KSR; 20-alpha-HSD; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-Hydroxysteroid dehydrogenase type 1; 17-beta-HSD 1
• Gene Name: HSD17B1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: CH-OH donor oxidoreductase
• UniProt ID: DHB1_HUMAN
• TTD ID: T44011
• EC Number: EC 1.1.1.62
• Sequence:
  MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
  ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
  RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
  LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
  FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
  GAGPGAEDEAGRGAVGDPELGDPPAAPQ
• Function: Has 20-alpha-HSD activity. Uses preferentially NADH. Favors the reduction of estrogens and androgens.
• KEGG Pathway:
  Steroid hormone biosynthesis (hsa00140)
  Metabolic pathways (hsa01100)
  Ovarian steroidogenesis (hsa04913)
• Reactome Pathway: The canonical retinoid cycle in rods (twilight vision) (R-HSA-2453902)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Naringenin	DMHAZLM	N. A.	N. A.	Phase 1	[1]

103 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,1':4',1''-terphenyl-3,3''-diol	DMGHAC7	Discovery agent	N.A.	Investigative	[2]
1,1':4',1''-terphenyl-3,4''-diol	DMA3LZ9	Discovery agent	N.A.	Investigative	[2]
1-Bromo-6-(3-hydroxyphenyl)-2-naphthol	DMU2PSQ	Discovery agent	N.A.	Investigative	[3]
16-(2',2'-Dimethyl)-propylidene-estradiol	DMK4N2F	Discovery agent	N.A.	Investigative	[4]
16-(2',2'-Dimethyl)-propylidene-estrone	DMQYJB1	Discovery agent	N.A.	Investigative	[4]
16-(4-cyano-benzylidene)-estradiol	DMTAXZI	Discovery agent	N.A.	Investigative	[4]
16-(4-dimethylamino-benzylidene)-estradiol	DMEH8I0	Discovery agent	N.A.	Investigative	[4]
16-(4-dimethylamino-benzylidene)-estrone	DMX8YCK	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-2-yl)methyl-estradiol	DMSXFG0	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-2-yl)methylene-estradiol	DMIC0OU	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-3-yl)methyl-estradiol	DMTD5AO	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-3-yl)methylene-estradiol	DMIMZ21	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-4-yl)methyl-estradiol	DM7NSRI	Discovery agent	N.A.	Investigative	[4]
16-(pyridin-4-yl)methylene-estradiol	DMOTNPC	Discovery agent	N.A.	Investigative	[4]
16-(thiophen-2-yl)methylene-estrone	DME3XS4	Discovery agent	N.A.	Investigative	[4]
16-beta-ethoxymethyl-estrone	DMWJNV5	Discovery agent	N.A.	Investigative	[4]
16-beta-hydroxymethyl-estradiol	DMUW07J	Discovery agent	N.A.	Investigative	[4]
16-isobutylidene-estradiol	DMTZG68	Discovery agent	N.A.	Investigative	[4]
16-isobutylidene-estrone	DMS7PL3	Discovery agent	N.A.	Investigative	[4]
16beta-cyano-estradiol	DMCMP9B	Discovery agent	N.A.	Investigative	[4]
2'-Monophosphoadenosine 5'-Diphosphoribose	DME9S8M	Discovery agent	N.A.	Investigative	[5]
2-(3-hydroxyphenyl)quinolin-6-ol	DMV9M57	Discovery agent	N.A.	Investigative	[6]
2-Fluoro-4-[5-(3-hydroxyphenyl)-2-thienyl]phenol	DMUGAT8	Discovery agent	N.A.	Investigative	[2]
2-Fluoro-4-[5-(3-hydroxyphenyl)-3-thienyl]phenol	DMGBEFY	Discovery agent	N.A.	Investigative	[2]
2-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol	DMKOUCM	Discovery agent	N.A.	Investigative	[2]
2-Hydroxy-N,6-bis(3-hydroxyphenyl)-1-naphthamide	DMQ0F96	Discovery agent	N.A.	Investigative	[3]
3'-(1-Benzothien-2-yl)biphenyl-3-ol	DMSZLNE	Discovery agent	N.A.	Investigative	[7]
3'-(5-Chloro-2-thienyl)biphenyl-3-ol	DMM4HF8	Discovery agent	N.A.	Investigative	[7]
3,3',3''-Thiene-2,3,5-triyltriphenol	DMH7A32	Discovery agent	N.A.	Investigative	[2]
3,3'-(1,2,4,5-tetrazine-3,6-diyl)diphenol	DM9GO8Y	Discovery agent	N.A.	Investigative	[8]
3,3'-(1,2,4-Thiadiazol-2,5-diyl)diphenol	DM4O2VC	Discovery agent	N.A.	Investigative	[8]
3,3'-(1,2,4-thiadiazole-3,5-diyl)diphenol	DMC34UW	Discovery agent	N.A.	Investigative	[8]
3,3'-(1,3-Thiazol-2,4-diyl)diphenol	DM9AJNW	Discovery agent	N.A.	Investigative	[8]
3,3'-(3-Methylthiene-2,5-diyl]diphenol	DM40SNY	Discovery agent	N.A.	Investigative	[2]
3,3'-(3-Phenylthiene-2,5-diyl)diphenol	DMUK1VX	Discovery agent	N.A.	Investigative	[2]
3,3'-pyrazine-2,5-diyldiphenol	DMZTIPJ	Discovery agent	N.A.	Investigative	[8]
3,3'-Pyridine-2,5-diyldiphenol	DMZILNC	Discovery agent	N.A.	Investigative	[8]
3,3'-Thiene-2,4-diyldiphenol	DMW7XFQ	Discovery agent	N.A.	Investigative	[8]
3,3'-thiene-2,5-diyldiphenol	DMWH0ER	Discovery agent	N.A.	Investigative	[2]
3,3-(1,3-Thiazole-2,5-diyl)diphenol	DMQY50A	Discovery agent	N.A.	Investigative	[8]
3,4'-(thiophene-2,4-diyl)diphenol	DMEN9T4	Discovery agent	N.A.	Investigative	[2]
3-(2-naphthyl)phenol	DM27HSO	Discovery agent	N.A.	Investigative	[6]
3-(3-hydroxyphenyl)quinolin-7-ol	DMP0DQE	Discovery agent	N.A.	Investigative	[6]
3-(5-phenyl-2-thienyl)phenol	DM5NIE7	Discovery agent	N.A.	Investigative	[2]
3-(6-hydroxy-2-naphthyl)benzoic acid	DMTIKF7	Discovery agent	N.A.	Investigative	[6]
3-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol	DMDPY9N	Discovery agent	N.A.	Investigative	[2]
3-Hydroxy-7-(3-hydroxyphenyl)-1-naphthonitrile	DM3SOFX	Discovery agent	N.A.	Investigative	[3]
3-[2-(5-Chloro-2-thienyl)pyridin-4-yl]phenol	DM5EJLD	Discovery agent	N.A.	Investigative	[7]
3-[3-(4-hydroxyphenyl)isoxazol-5-yl]phenol	DMNC6W9	Discovery agent	N.A.	Investigative	[9]
3-[4-(4-Hydroxyphenyl)-1,3-oxazol-2-yl]phenol	DMIM5WE	Discovery agent	N.A.	Investigative	[9]
3-[4-(5-Chloro-2-thienyl)pyridin-2-yl]phenol	DMZCO83	Discovery agent	N.A.	Investigative	[7]
3-[5-(3,4-Difluorophenyl)-2-thienyl]phenol	DMYZIG3	Discovery agent	N.A.	Investigative	[2]
3-[5-(3-Fluorophenyl)-2-thienyl]phenol	DMD5QOW	Discovery agent	N.A.	Investigative	[2]
3-[5-(4-Fluorophenyl)-2-thienyl]phenol	DMYZ2U0	Discovery agent	N.A.	Investigative	[2]
3-[5-(4-hydroxyphenyl)-1,3-oxazol-2-yl]phenol	DM4TFMA	Discovery agent	N.A.	Investigative	[8]
3-[5-(4-hydroxyphenyl)-1,3-thiazol-2-yl]phenol	DM2IXO0	Discovery agent	N.A.	Investigative	[2]
3-[5-(4-Hydroxyphenyl)-2-thienyl]-5-methylphenol	DMAMOJE	Discovery agent	N.A.	Investigative	[2]
3-[5-(4-hydroxyphenyl)-2-thienyl]phenol	DMSFW9T	Discovery agent	N.A.	Investigative	[2]
3-[5-(4-Hydroxyphenyl)-3-thienyl]phenol	DM40GJ8	Discovery agent	N.A.	Investigative	[8]
3-[6-(5-Chloro-2-thienyl)pyridin-2-yl]phenol	DMLTZ5F	Discovery agent	N.A.	Investigative	[7]
4'-(5-Chloro-2-thienyl)biphenyl-3-ol	DMDYBIC	Discovery agent	N.A.	Investigative	[7]
4'-(6-Methoxypyridin-3-yl)biphenyl-3-ol	DM4B73F	Discovery agent	N.A.	Investigative	[7]
4-ANDROSTENE-3-17-DIONE	DMSE8NU	Discovery agent	N.A.	Investigative	[5], [10]
4-Fluoro-1,1':4',1''-terphenyl-3,3''-diol	DM0INZX	Discovery agent	N.A.	Investigative	[2]
4-Methyl-1,1':4',1''-terphenyl-3,4''-diol	DM2IZA3	Discovery agent	N.A.	Investigative	[2]
4-[5-(3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol	DMK4ICB	Discovery agent	N.A.	Investigative	[2]
4-[5-(3-Hydroxyphenyl)-2-thienyl]benzene-1,2-diol	DMZHVFO	Discovery agent	N.A.	Investigative	[2]
4-[5-(3-Hydroxyphenyl)-3-thienyl]-2-methylphenol	DM7ERYJ	Discovery agent	N.A.	Investigative	[2]
5-(6-hydroxy-2-naphthyl)pyridin-3-ol	DMJWIPS	Discovery agent	N.A.	Investigative	[6]
5alpha-Androstan-3,17-Dione	DMHI7Y2	Discovery agent	N.A.	Investigative	[5]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol	DMH8WA2	Discovery agent	N.A.	Investigative	[3]
6-(3-Hydroxyphenyl)-1-phenyl-2-naphthol	DMMZENV	Discovery agent	N.A.	Investigative	[3]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol	DM2V9XI	Discovery agent	N.A.	Investigative	[6]
6-oxo-16-formyl-estrone	DMPBE5H	Discovery agent	N.A.	Investigative	[4]
6-oxo-estrone	DMKMYAJ	Discovery agent	N.A.	Investigative	[4]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol	DM2I91C	Discovery agent	N.A.	Investigative	[6]
7-Hydroxy-3-(3-hydroxyphenyl)-1-naphthonitrile	DMS2NZA	Discovery agent	N.A.	Investigative	[3]
Apigenin	DMI3491	Discovery agent	N.A.	Investigative	[1]
EM-1745	DM3RSYO	Discovery agent	N.A.	Investigative	[5]
Equilin	DM9PT03	Discovery agent	N.A.	Investigative	[5]
Ethyl estrone-16-methylcarboxylate	DMXTLJE	Discovery agent	N.A.	Investigative	[4]
Kaempferol	DMHEMUB	Discovery agent	N.A.	Investigative	[1]
Methyl estradiol-16-beta-carboxylate	DMG8XD1	Discovery agent	N.A.	Investigative	[4]
N,N-diethyl estrone-16-methyl carboxamide	DMZ3EA1	Discovery agent	N.A.	Investigative	[4]
N-(1'-Phenyl-ethyl) estradiol-16-carboxamide	DM6DEZ4	Discovery agent	N.A.	Investigative	[4]
N-(4'-methyl-piperazinyl) estradiol-16-carboxamide	DMXNMTD	Discovery agent	N.A.	Investigative	[4]
N-(furan-2-ylmethyl)-estrone-16-methyl carboxamide	DM0DZ9J	Discovery agent	N.A.	Investigative	[4]
N-(furan-2-ylmethyl)estradiol-16-carboxamide	DMLJZGD	Discovery agent	N.A.	Investigative	[4]
N-(pyridin-3-ylmethyl) estradiol-16-carboxamide	DMBJKH1	Discovery agent	N.A.	Investigative	[4]
N-(pyridin-4-ylmethyl) estradiol-16-carboxamide	DMYFAQV	Discovery agent	N.A.	Investigative	[4]
N-ethyl estradiol-16-methyl carboxamide	DM1W2GZ	Discovery agent	N.A.	Investigative	[4]
N-ethyl estrone-16-methyl carboxamide	DMM9526	Discovery agent	N.A.	Investigative	[4]
N-isopropyl estradiol-16-carboxamide	DMFSW5M	Discovery agent	N.A.	Investigative	[4]
N-isopropyl estradiol-16-methyl carboxamide	DMHJMTI	Discovery agent	N.A.	Investigative	[4]
N-isopropyl estrone-16-methyl carboxamide	DMZGMQJ	Discovery agent	N.A.	Investigative	[4]
N-methoxyethyl estrone-16-methyl carboxamide	DMI9QRO	Discovery agent	N.A.	Investigative	[4]
N-methyl estradiol-16-methyl carboxamide	DM32YID	Discovery agent	N.A.	Investigative	[4]
N-methyl estrone-16-methyl carboxamide	DM7XIK5	Discovery agent	N.A.	Investigative	[4]
N-methyl-N-ethyl estradiol-16-carboxamide	DM6DM4L	Discovery agent	N.A.	Investigative	[4]
N-methyl-N-ethyl estrone-16-methyl carboxamide	DM2CUEB	Discovery agent	N.A.	Investigative	[4]
N-N-diethyl estradiol-16-methyl carboxamide	DMUHZ23	Discovery agent	N.A.	Investigative	[4]
Nicotinamide-Adenine-Dinucleotide	DM9LRKB	N. A.	N. A.	Investigative	[5]
NSC-94258	DM6VY3P	Discovery agent	N.A.	Investigative	[1]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Estradiol 17-beta-dehydrogenase 1 (HSD17B1) DME Info
• Gene Name: HSD17B1

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Prasterone	DM67VKL	Chronic obstructive pulmonary disease	CA22	Approved	[11]

References

• [1] Discovery of nonsteroidal 17beta-hydroxysteroid dehydrogenase 1 inhibitors by pharmacophore-based screening of virtual compound libraries. J Med Chem. 2008 Jul 24;51(14):4188-99.
• [2] New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxyst... J Med Chem. 2009 Nov 12;52(21):6724-43.
• [3] Substituted 6-phenyl-2-naphthols. Potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1): design,... J Med Chem. 2008 Aug 14;51(15):4685-98.
• [4] Modification of estrone at the 6, 16, and 17 positions: novel potent inhibitors of 17beta-hydroxysteroid dehydrogenase type 1. J Med Chem. 2006 Feb 23;49(4):1325-45.
• [5] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [6] Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors... J Med Chem. 2008 Apr 10;51(7):2158-69.
• [7] Novel estrone mimetics with high 17beta-HSD1 inhibitory activity. Bioorg Med Chem. 2010 May 15;18(10):3494-505.
• [8] Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as p... J Med Chem. 2008 Nov 13;51(21):6725-39.
• [9] Design, synthesis and biological evaluation of bis(hydroxyphenyl) azoles as potent and selective non-steroidal inhibitors of 17beta-hydroxysteroid ... Bioorg Med Chem. 2008 Jun 15;16(12):6423-35.
• [10] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [11] Steroid signalling in the ovarian surface epithelium. Trends Endocrinol Metab. 2005 Sep;16(7):327-33.