Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT00UZBM)

DOT Name Pregnancy-specific beta-1-glycoprotein 8 (PSG8)
Synonyms PS-beta-G-8; PSBG-8; Pregnancy-specific glycoprotein 8
Gene Name PSG8
Related Disease
Type-1 diabetes ( )
Frontotemporal dementia ( )
Hydatidiform mole ( )
Hydatidiform mole, recurrent, 1 ( )
Mitochondrial disease ( )
Parkinsonian disorder ( )
Promyelocytic leukaemia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Cervical cancer ( )
Helicoid peripapillary chorioretinal degeneration ( )
Neoplasm ( )
UniProt ID
PSG8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13895 ; PF13927 ; PF07686
Sequence
MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQ
NLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSY
TLHIIMGGDENRGVTGHFTFTLYLETPKPSISSSKLNPREAMEAVSLTCDPETPDASYLW
WMNGQSLPMSHRLQLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPFTLNLLPKLP
KPYITINNLKPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV
TRNETGPYQCEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNP
PAQYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPV
SLAIGI
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Type-1 diabetes DIS7HLUB Definitive Biomarker [1]
Frontotemporal dementia DISKYHXL Strong Biomarker [2]
Hydatidiform mole DISKNP7O Strong Genetic Variation [3]
Hydatidiform mole, recurrent, 1 DISXUJWE Strong Genetic Variation [3]
Mitochondrial disease DISKAHA3 Strong Biomarker [4]
Parkinsonian disorder DISHGY45 Strong Biomarker [2]
Promyelocytic leukaemia DISYGG13 Strong Altered Expression [5]
Prostate cancer DISF190Y Strong Biomarker [6]
Prostate carcinoma DISMJPLE Strong Biomarker [6]
Cervical cancer DISFSHPF Limited Biomarker [7]
Helicoid peripapillary chorioretinal degeneration DISFSS5N Limited Altered Expression [8]
Neoplasm DISZKGEW Limited Biomarker [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 8 (PSG8). [10]
------------------------------------------------------------------------------------

References

1 Effects of a Ganoderma atrum polysaccharide against pancreatic damage in streptozotocin-induced diabetic mice.Food Funct. 2019 Nov 1;10(11):7227-7238. doi: 10.1039/c9fo01990a. Epub 2019 Oct 16.
2 Tau gene mutation in familial progressive subcortical gliosis.Nat Med. 1999 Apr;5(4):454-7. doi: 10.1038/7454.
3 Linkage of two human pregnancy-specific beta 1-glycoprotein genes: one is associated with hydatidiform mole.Proc Natl Acad Sci U S A. 1990 Aug;87(15):5822-6. doi: 10.1073/pnas.87.15.5822.
4 Ganoderma atrum polysaccharide improves doxorubicin-induced cardiotoxicity in mice by regulation of apoptotic pathway in mitochondria.Carbohydr Polym. 2018 Dec 15;202:581-590. doi: 10.1016/j.carbpol.2018.08.144. Epub 2018 Sep 3.
5 A pregnancy-specific beta 1-glycoprotein, a CEA gene family member, expressed in a human promyelocytic leukemia cell line, HL-60: structures of protein, mRNA and gene.Biochem Biophys Res Commun. 1989 Sep 15;163(2):1021-31. doi: 10.1016/0006-291x(89)92324-3.
6 Predictive value of the UICC and AJCC 8th edition tumor-nodes-metastasis (TNM) classification for patients treated with radical prostatectomy.Cancer Epidemiol. 2018 Oct;56:126-132. doi: 10.1016/j.canep.2018.08.007. Epub 2018 Aug 31.
7 Sodium butyrate produces concordant expression of "early placental" alkaline phosphatase, pregnancy-specific beta 1-glycoprotein and human chronic gonadotropin beta-subunit in a newly established uterine cervical cancer cell line (SKG-IIIa).Int J Cancer. 1983 Sep 15;32(3):267-72. doi: 10.1002/ijc.2910320302.
8 Evaluation of the protective effects of Ganoderma atrum polysaccharide on acrylamide-induced injury in small intestine tissue of rats.Food Funct. 2019 Sep 1;10(9):5863-5872. doi: 10.1039/c9fo01452g. Epub 2019 Aug 29.
9 Toll-like receptor 4 mediates the antitumor host response induced by Ganoderma atrum polysaccharide.J Agric Food Chem. 2015 Jan 21;63(2):517-25. doi: 10.1021/jf5041096. Epub 2015 Jan 9.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.