General Information of Drug Off-Target (DOT) (ID: OT0IPRVR)

DOT Name Histone-arginine methyltransferase CARM1 (CARM1)
Synonyms EC 2.1.1.319; Coactivator-associated arginine methyltransferase 1; Protein arginine N-methyltransferase 4
Gene Name CARM1
UniProt ID
CARM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2Y1W; 2Y1X; 4IKP; 5DWQ; 5DX0; 5DX1; 5DX8; 5DXA; 5DXJ; 5U4X; 6ARJ; 6ARV; 6D2L; 6DVR; 6IZQ; 6S70; 6S71; 6S74; 6S77; 6S79; 6S7A; 6S7B; 6S7C; 7FAI; 7FAJ; 7U9I
EC Number
2.1.1.319
Pfam ID
PF11531 ; PF06325
Sequence
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Function
Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability. Recruited to promoters upon gene activation together with histone acetyltransferases from EP300/P300 and p160 families, methylates histone H3 at 'Arg-17' (H3R17me), forming mainly asymmetric dimethylarginine (H3R17me2a), leading to activates transcription via chromatin remodeling. During nuclear hormone receptor activation and TCF7L2/TCF4 activation, acts synergically with EP300/P300 and either one of the p160 histone acetyltransferases NCOA1/SRC1, NCOA2/GRIP1 and NCOA3/ACTR or CTNNB1/beta-catenin to activate transcription. During myogenic transcriptional activation, acts together with NCOA3/ACTR as a coactivator for MEF2C. During monocyte inflammatory stimulation, acts together with EP300/P300 as a coactivator for NF-kappa-B. Acts as a coactivator for PPARG, promotes adipocyte differentiation and the accumulation of brown fat tissue. Plays a role in the regulation of pre-mRNA alternative splicing by methylation of splicing factors. Also seems to be involved in p53/TP53 transcriptional activation. Methylates EP300/P300, both at 'Arg-2142', which may loosen its interaction with NCOA2/GRIP1, and at 'Arg-580' and 'Arg-604' in the KIX domain, which impairs its interaction with CREB and inhibits CREB-dependent transcriptional activation. Also methylates arginine residues in RNA-binding proteins PABPC1, ELAVL1 and ELAV4, which may affect their mRNA-stabilizing properties and the half-life of their target mRNAs. Acts as a transcriptional coactivator of ACACA/acetyl-CoA carboxylase by enriching H3R17 methylation at its promoter, thereby positively regulating fatty acid synthesis. Independently of its methyltransferase activity, involved in replication fork progression: promotes PARP1 recruitment to replication forks, leading to poly-ADP-ribosylation of chromatin at replication forks and reduced fork speed.
Tissue Specificity Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia.
KEGG Pathway
Endocrine resistance (hsa01522 )
Reactome Pathway
BMAL1 (R-HSA-1368108 )
PPARA activates gene expression (R-HSA-1989781 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )
RMTs methylate histone arginines (R-HSA-3214858 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Regulation of lipid metabolism by PPARalpha (R-HSA-400206 )
Circadian Clock (R-HSA-400253 )
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 )
Estrogen-dependent gene expression (R-HSA-9018519 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Heme signaling (R-HSA-9707616 )
RORA activates gene expression (R-HSA-1368082 )
BioCyc Pathway
MetaCyc:HS13925-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Histone-arginine methyltransferase CARM1 (CARM1). [1]
[3H]cAMP DMZRQU7 Investigative [3H]cAMP increases the phosphorylation of Histone-arginine methyltransferase CARM1 (CARM1). [12]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [6]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [7]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [9]
Ribavirin DMEYLH9 Phase 1 Trial Ribavirin decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Histone-arginine methyltransferase CARM1 (CARM1). [11]
(L-)-S-adenosyl-L-homocysteine DMDUN83 Investigative (L-)-S-adenosyl-L-homocysteine decreases the activity of Histone-arginine methyltransferase CARM1 (CARM1). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
8 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
9 Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
10 Ribavirin inhibits the growth and ascites formation of hepatocellular carcinoma through downregulation of type I CARM1 and type II PRMT5. Toxicol Appl Pharmacol. 2022 Jan 15;435:115829. doi: 10.1016/j.taap.2021.115829. Epub 2021 Dec 14.
11 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
12 CARM1 mediates the ligand-independent and tamoxifen-resistant activation of the estrogen receptor alpha by cAMP. Genes Dev. 2010 Apr 1;24(7):708-19. doi: 10.1101/gad.568410.
13 Ribavirin inhibits colorectal cancer growth by downregulating PRMT5 expression and H3R8me2s and H4R3me2s accumulation. Toxicol Appl Pharmacol. 2021 Mar 15;415:115450. doi: 10.1016/j.taap.2021.115450. Epub 2021 Feb 9.