Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0R3QD3)

DOT Name Homeobox protein BarH-like 2 (BARX2)
Gene Name BARX2
Related Disease
Adenocarcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Colorectal carcinoma ( )
Gastric cancer ( )
Narcolepsy ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Stomach cancer ( )
Epithelial ovarian cancer ( )
Lupus nephritis ( )
Systemic lupus erythematosus ( )
UniProt ID
BARX2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS
CTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSE
SETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW
YQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQ
EELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS
Function
Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. May be involved in controlling adhesive processes in keratinizing epithelia.
Tissue Specificity Highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Strong Altered Expression [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [3]
Gastric cancer DISXGOUK Strong Biomarker [4]
Narcolepsy DISLCNLI Strong Genetic Variation [5]
Neoplasm DISZKGEW Strong Biomarker [6]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [7]
Ovarian cancer DISZJHAP Strong Altered Expression [8]
Ovarian neoplasm DISEAFTY Strong Altered Expression [8]
Stomach cancer DISKIJSX Strong Biomarker [4]
Epithelial ovarian cancer DIS56MH2 Limited Biomarker [1]
Lupus nephritis DISCVGPZ Limited Genetic Variation [9]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Homeobox protein BarH-like 2 (BARX2). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Homeobox protein BarH-like 2 (BARX2). [11]
------------------------------------------------------------------------------------

References

1 The homeobox gene BARX2 can modulate cisplatin sensitivity in human epithelial ovarian cancer.Int J Oncol. 2002 Nov;21(5):929-33.
2 BARX2 and estrogen receptor-alpha (ESR1) coordinately regulate the production of alternatively spliced ESR1 isoforms and control breast cancer cell growth and invasion.Oncogene. 2006 Aug 31;25(39):5426-35. doi: 10.1038/sj.onc.1209529. Epub 2006 Apr 24.
3 Down-regulation of Barx2 predicts poor survival in colorectal cancer.Biochem Biophys Res Commun. 2016 Sep 9;478(1):67-73. doi: 10.1016/j.bbrc.2016.07.091. Epub 2016 Jul 22.
4 Downregulation of homeobox gene Barx2 increases gastric cancer proliferation and metastasis and predicts poor patient outcomes.Oncotarget. 2016 Sep 13;7(37):60593-60608. doi: 10.18632/oncotarget.11260.
5 Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
6 Downregulation of BarH-like homeobox 2 promotes cell proliferation, migration and aerobic glycolysis through Wnt/-catenin signaling, and predicts a poor prognosis in non-small cell lung carcinoma.Thorac Cancer. 2018 Mar;9(3):390-399. doi: 10.1111/1759-7714.12593. Epub 2018 Jan 17.
7 miR-942 promotes tumor migration, invasion, and angiogenesis by regulating EMT via BARX2 in non-small-cell lung cancer.J Cell Physiol. 2019 Dec;234(12):23596-23607. doi: 10.1002/jcp.28928. Epub 2019 Jun 24.
8 BARX2 induces cadherin 6 expression and is a functional suppressor of ovarian cancer progression.Cancer Res. 2001 Oct 1;61(19):6977-81.
9 Response to Intravenous Cyclophosphamide Treatment for Lupus Nephritis Associated with Polymorphisms in the FCGR2B-FCRLA Locus.J Rheumatol. 2016 Jun;43(6):1045-9. doi: 10.3899/jrheum.150665. Epub 2016 Mar 15.
10 Proteomic analysis of antiproliferative effects by treatment of 5-fluorouracil in cervical cancer cells. DNA Cell Biol. 2004 Nov;23(11):769-76.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.