Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1THGOP)

• DOT Name: Prolactin-releasing peptide receptor (PRLHR)
• Synonyms: PrRP receptor; PrRPR; G-protein coupled receptor 10; hGR3
• Gene Name: PRLHR
• Related Disease:
  Colorectal carcinoma
  Dyspepsia
  Gastric cancer
  Insomnia
  Leiomyoma
  Obesity
  Peripheral neuropathy
  Pituitary adenoma
  Stomach cancer
  Tarsal-carpal coalition syndrome
  Uterine fibroids
• UniProt ID: PRLHR_HUMAN
• Pfam ID: PF00001
• Sequence:
  MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
  GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY
  AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV
  LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV
  ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL
  RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH
  GQNMTVSVVI
• Function: Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
• Tissue Specificity: Only detected in the pituitary gland and in all cell types of pituitary adenomas.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway: Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[1]
Dyspepsia	DISYEEY6	Strong	Genetic Variation	[2]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[1]
Insomnia	DIS0AFR7	Strong	Genetic Variation	[2]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[3]
Obesity	DIS47Y1K	Strong	Biomarker	[4]
Peripheral neuropathy	DIS7KN5G	Strong	Genetic Variation	[2]
Pituitary adenoma	DISJ5R1X	Strong	Biomarker	[5]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[1]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Genetic Variation	[6]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Prolactin-releasing peptide receptor (PRLHR).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Prolactin-releasing peptide receptor (PRLHR).	[8]

References

• [1] Polymorphisms of PRLHR and HSPA12A and risk of gastric and colorectal cancer in the Chinese Han population.BMC Gastroenterol. 2015 Aug 25;15:107. doi: 10.1186/s12876-015-0336-9.
• [2] Incidence of infusion hypersensitivity reaction after withholding dexamethasone premedication in early breast cancer patients not experiencing two previous cycles of infusion hypersensitivity reaction for weekly paclitaxel chemotherapy.Support Care Cancer. 2018 Jul;26(7):2471-2477. doi: 10.1007/s00520-018-4087-3. Epub 2018 Feb 12.
• [3] The Epidemiology and Genetics of Uterine Leiomyoma.Best Pract Res Clin Obstet Gynaecol. 2016 Jul;34:3-12. doi: 10.1016/j.bpobgyn.2015.11.018. Epub 2015 Dec 2.
• [4] Mutated G-protein-coupled receptor GPR10 is responsible for the hyperphagia/dyslipidaemia/obesity locus of Dmo1 in the OLETF rat.Clin Exp Pharmacol Physiol. 2005 May-Jun;32(5-6):355-66. doi: 10.1111/j.1440-1681.2005.04196.x.
• [5] Does prolactin releasing peptide receptor regulate prolactin-secretion in human pituitary adenomas?.Neurosci Lett. 2000 Sep 22;291(3):159-62. doi: 10.1016/s0304-3940(00)01413-0.
• [6] Cytology, flow cytometry, image analysis, and interphase cytogenetics by fluorescence in situ hybridization in the diagnosis of transitional cell carcinoma in bladder washes: a comparative study.Diagn Cytopathol. 1995 Oct;13(3):214-23; discussion 224. doi: 10.1002/dc.2840130307.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.