Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1XE7MJ)

• DOT Name: Leukocyte receptor cluster member 1 (LENG1)
• Gene Name: LENG1
• UniProt ID: LENG1_HUMAN
• Pfam ID: PF10197
• Sequence:
  MNILPKKSWHVRNKDNVARVRRDEAQAREEEKERERRVLLAQQEARTEFLRKKARHQNSL
  PELEAAEAGAPGSGPVDLFRELLEEGKGVIRGNKEYKEEKRQEKERQEKALGILTYLGQS
  AAEAQTQPPWYQLPPGRGGPPPGPAPDEKIKSRLDPLREMQKHLGKKRQHGGDEGSRSRK
  EKEGSEKQRPKEPPSLDQLRAERLRREAAERSRAEALLARVQGRALQEGQPEEDETDDRR
  RRYNSQFNPQLARRPRQQDPHLTH
• Reactome Pathway: mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Leukocyte receptor cluster member 1 (LENG1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Leukocyte receptor cluster member 1 (LENG1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Leukocyte receptor cluster member 1 (LENG1).	[3]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Leukocyte receptor cluster member 1 (LENG1).	[4]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Leukocyte receptor cluster member 1 (LENG1).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Leukocyte receptor cluster member 1 (LENG1).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Leukocyte receptor cluster member 1 (LENG1).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Leukocyte receptor cluster member 1 (LENG1).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Leukocyte receptor cluster member 1 (LENG1).	[8]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Leukocyte receptor cluster member 1 (LENG1).	[8]

References

• [1] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [5] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.