Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT20VCWP)

• DOT Name: Prostate-associated microseminoprotein (MSMP)
• Synonyms: PC3-secreted microprotein
• Gene Name: MSMP
• Related Disease:
  Colitis
  Liver cirrhosis
  Prostate cancer
  Prostate carcinoma
  Ulcerative colitis
  Neoplasm
• UniProt ID: MSMP_HUMAN
• Pfam ID: PF05825
• Sequence:
  MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
  RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
  PEWGSANTPVPGAPAPHSS
• Function: Acts as a ligand for C-C chemokine receptor CCR2. Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions. Exhibits a chemotactic activity for monocytes and lymphocytes but not neutrophils.
• Tissue Specificity: Detected in prostate epithelium (at protein level) . Detected in trachea and testis . Highly expressed in benign prostatic hyperplasia and in some prostate cancers, and can also be detected in breast tumor tissue .

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colitis	DISAF7DD	Strong	Biomarker	[1]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[3]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Disputed	Biomarker	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Prostate-associated microseminoprotein (MSMP).	[5]

References

• [1] The PSMP-CCR2 interactions trigger monocyte/macrophage-dependent colitis.Sci Rep. 2017 Jul 11;7(1):5107. doi: 10.1038/s41598-017-05255-7.
• [2] PSMP/MSMP promotes hepatic fibrosis through CCR2 and represents a novel therapeutic target.J Hepatol. 2020 Mar;72(3):506-518. doi: 10.1016/j.jhep.2019.09.033. Epub 2019 Dec 6.
• [3] Elevated Expression Levels of PC3-Secreted Microprotein (PSMP) in Prostate Cancer Associated With Increased Xenograft Growth and Modification of Immune-Related Microenvironment.Front Oncol. 2019 Aug 28;9:724. doi: 10.3389/fonc.2019.00724. eCollection 2019.
• [4] A highly conserved protein secreted by the prostate cancer cell line PC-3 is expressed in benign and malignant prostate tissue.Biol Chem. 2007 Mar;388(3):289-95. doi: 10.1515/BC.2007.032.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.