Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2OFNGF)

• DOT Name: MOB kinase activator 3C (MOB3C)
• Synonyms: Mob1 homolog 2C; Mps one binder kinase activator-like 2C
• Gene Name: MOB3C
• Related Disease:
  Chronic kidney disease
  High blood pressure
  Myocardial infarction
• UniProt ID: MOB3C_HUMAN
• Pfam ID: PF03637
• Sequence:
  MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWI
  AVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMAL
  LMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEA
  HVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
• Function: May regulate the activity of kinases.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic kidney disease	DISW82R7	Strong	Biomarker	[1]
High blood pressure	DISY2OHH	Strong	Biomarker	[1]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of MOB kinase activator 3C (MOB3C).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of MOB kinase activator 3C (MOB3C).	[7]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of MOB kinase activator 3C (MOB3C).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MOB kinase activator 3C (MOB3C).	[4]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of MOB kinase activator 3C (MOB3C).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of MOB kinase activator 3C (MOB3C).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of MOB kinase activator 3C (MOB3C).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of MOB kinase activator 3C (MOB3C).	[9]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of MOB kinase activator 3C (MOB3C).	[10]

References

• [1] Identification of 13 novel susceptibility loci for early-onset myocardial infarction, hypertension, or chronic kidney disease.Int J Mol Med. 2018 Nov;42(5):2415-2436. doi: 10.3892/ijmm.2018.3852. Epub 2018 Sep 4.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.