Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2VRFTM)

DOT Name Bcl-2-like protein 13 (BCL2L13)
Synonyms Bcl2-L-13; Bcl-rambo; Protein Mil1
Gene Name BCL2L13
Related Disease
Adult glioblastoma ( )
Childhood acute lymphoblastic leukemia ( )
Glioblastoma multiforme ( )
Hepatocellular carcinoma ( )
Lafora disease ( )
Neoplasm ( )
UniProt ID
B2L13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00452
Sequence
MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK
TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH
KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ
FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES
PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN
NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP
DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL
ALRKK
Function May promote the activation of caspase-3 and apoptosis.
Tissue Specificity Ubiquitous, with the highest levels of expression in heart, placenta and pancreas.
KEGG Pathway
Mitophagy - animal (hsa04137 )
Legionellosis (hsa05134 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Strong Biomarker [1]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [2]
Glioblastoma multiforme DISK8246 Strong Altered Expression [1]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [3]
Lafora disease DIS83JHH Strong Altered Expression [4]
Neoplasm DISZKGEW Strong Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Bcl-2-like protein 13 (BCL2L13). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Bcl-2-like protein 13 (BCL2L13). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Bcl-2-like protein 13 (BCL2L13). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Bcl-2-like protein 13 (BCL2L13). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Bcl-2-like protein 13 (BCL2L13). [9]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Bcl-2-like protein 13 (BCL2L13). [10]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of Bcl-2-like protein 13 (BCL2L13). [11]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Bcl-2-like protein 13 (BCL2L13). [12]
Duvelisib DM7USVA Phase 2 Trial Duvelisib increases the expression of Bcl-2-like protein 13 (BCL2L13). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Bcl-2-like protein 13 (BCL2L13). [14]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Bcl-2-like protein 13 (BCL2L13). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Coumarin DM0N8ZM Investigative Coumarin affects the phosphorylation of Bcl-2-like protein 13 (BCL2L13). [15]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the phosphorylation of Bcl-2-like protein 13 (BCL2L13). [17]
------------------------------------------------------------------------------------

References

1 Bcl2L13 is a ceramide synthase inhibitor in glioblastoma.Proc Natl Acad Sci U S A. 2014 Apr 15;111(15):5682-7. doi: 10.1073/pnas.1316700111. Epub 2014 Mar 31.
2 Expression and prognostic significance of the apoptotic genes BCL2L13, Livin, and CASP8AP2 in childhood acute lymphoblastic leukemia.Leuk Res. 2010 Jan;34(1):18-23. doi: 10.1016/j.leukres.2009.07.023.
3 Macrophage membrane interleukin 1 regulates the expression of acute phase proteins in human hepatoma Hep 3B cells.J Immunol. 1987 Sep 15;139(6):1896-901.
4 Degradation of altered mitochondria by autophagy is impaired in Lafora disease.FEBS J. 2018 Jun;285(11):2071-2090. doi: 10.1111/febs.14468. Epub 2018 Apr 23.
5 Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
6 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
7 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
11 The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Duvelisib treatment is associated with altered expression of apoptotic regulators that helps in sensitization of chronic lymphocytic leukemia cells to venetoclax (ABT-199). Leukemia. 2017 Sep;31(9):1872-1881. doi: 10.1038/leu.2016.382. Epub 2016 Dec 26.
14 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
15 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
16 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
17 Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.