Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2VU9TN)

• DOT Name: Uncharacterized protein C15orf62, mitochondrial (C15ORF62)
• Gene Name: C15ORF62
• UniProt ID: CO062_HUMAN
• Sequence:
  METWRKGSFRNASFFKQLSLGRPRRLRRQSSVLSQASTAGGDHEEYSNREVIRELQGRPD
  GRRLPLWGDEQPRATLLAPPKPPRLYRESSSCPNILEPPPAYTAAYSATLPSALSLSSAL
  HQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[10]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[9]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein C15orf62, mitochondrial (C15ORF62).	[11]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.