Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2WQPNQ)

• DOT Name: Testis-specific basic protein Y 2 (BPY2)
• Synonyms: Basic charge, Y-linked 2; Variably charged protein Y 2
• Gene Name: BPY2
• Related Disease:
  Azoospermia
  Breast cancer
  Breast carcinoma
  Lung adenocarcinoma
  Oligospermia
  Prostate cancer
  Prostate carcinoma
• UniProt ID: VCY2_HUMAN
• Sequence:
  MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNT
  LLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
• Tissue Specificity: Expressed exclusively in testis. Expressed in ejaculated spermatozoa of germ cell. Expressed in the nuclei of spermatogonia, spermatocytes, and round spermatids, except elongated spermatids (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Azoospermia	DIS94181	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[2]
Oligospermia	DIS6YJF3	Strong	Altered Expression	[3]
Prostate cancer	DISF190Y	Limited	Altered Expression	[4]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Testis-specific basic protein Y 2 (BPY2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Testis-specific basic protein Y 2 (BPY2).	[6]

References

• [1] VCY2 protein interacts with the HECT domain of ubiquitin-protein ligase E3A.Biochem Biophys Res Commun. 2002 Sep 6;296(5):1104-11. doi: 10.1016/s0006-291x(02)02040-5.
• [2] The biological effect of the nitroimidazole derivative of a polypyridyl ruthenium complex on cancer and endothelial cells.Metallomics. 2015 Mar;7(3):553-66. doi: 10.1039/c5mt00037h.
• [3] Specific expression of VCY2 in human male germ cells and its involvement in the pathogenesis of male infertility.Biol Reprod. 2003 Sep;69(3):746-51. doi: 10.1095/biolreprod.103.015792. Epub 2003 Apr 30.
• [4] DNA methylation regulates the expression of Y chromosome specific genes in prostate cancer.J Urol. 2002 Jan;167(1):335-8.
• [5] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [6] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.