Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2YERNV)

• DOT Name: Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP)
• Synonyms: PTPRC-associated protein; CD45-associated protein; CD45-AP; Lymphocyte phosphatase-associated phosphoprotein
• Gene Name: PTPRCAP
• Related Disease:
  Gastric cancer
  Stomach cancer
  Multiple sclerosis
• UniProt ID: PTCA_HUMAN
• Pfam ID: PF15713
• Sequence:
  MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD
  SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD
  GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL
  HAFAGSAAWDDSARAAGGQGLHVTAL

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[1]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[1]
Multiple sclerosis	DISB2WZI	Limited	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[3]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[6]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[7]
Pantothenic acid	DM091H2	Approved	Pantothenic acid increases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[10]
Choline	DM5D9YK	Investigative	Choline affects the expression of Protein tyrosine phosphatase receptor type C-associated protein (PTPRCAP).	[11]

References

• [1] A regulatory polymorphism at position -309 in PTPRCAP is associated with susceptibility to diffuse-type gastric cancer and gene expression.Neoplasia. 2009 Dec;11(12):1340-7. doi: 10.1593/neo.91132.
• [2] PTPRC (CD45) C77G mutation does not contribute to multiple sclerosis susceptibility in Sardinian patients.J Neurol. 2004 Sep;251(9):1085-8. doi: 10.1007/s00415-004-0485-1.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [8] Calcium pantothenate modulates gene expression in proliferating human dermal fibroblasts. Exp Dermatol. 2009 Nov;18(11):969-78. doi: 10.1111/j.1600-0625.2009.00884.x. Epub 2009 Apr 8.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.